Comparing PP_3721 FitnessBrowser__Putida:PP_3721 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
40% identity, 96% coverage: 6:387/396 of query aligns to 4:383/385 of Q56232
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
40% identity, 96% coverage: 6:385/396 of query aligns to 4:381/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
40% identity, 96% coverage: 6:385/396 of query aligns to 4:381/382 of 1bjwA
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
40% identity, 96% coverage: 6:385/396 of query aligns to 4:381/382 of 1b5oA
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
41% identity, 92% coverage: 20:385/396 of query aligns to 19:381/382 of 1gc4A
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
41% identity, 92% coverage: 20:385/396 of query aligns to 19:381/382 of 1gc3A
Sites not aligning to the query:
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
37% identity, 90% coverage: 32:388/396 of query aligns to 25:384/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
37% identity, 90% coverage: 32:388/396 of query aligns to 25:384/388 of 1gd9A
Q02635 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.79 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
34% identity, 93% coverage: 20:386/396 of query aligns to 19:397/400 of Q02635
Sites not aligning to the query:
6f77A Crystal structure of the prephenate aminotransferase from rhizobium meliloti (see paper)
34% identity, 93% coverage: 20:386/396 of query aligns to 18:396/399 of 6f77A
6f35A Crystal structure of the aspartate aminotranferase from rhizobium meliloti (see paper)
35% identity, 92% coverage: 20:383/396 of query aligns to 19:393/400 of 6f35A
P58350 Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
34% identity, 92% coverage: 20:383/396 of query aligns to 29:403/410 of P58350
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
33% identity, 93% coverage: 15:382/396 of query aligns to 20:378/384 of 1o4sB
1j32A Aspartate aminotransferase from phormidium lapideum
33% identity, 92% coverage: 20:384/396 of query aligns to 18:382/388 of 1j32A
5wmiA Arabidopsis thaliana prephenate aminotransferase mutant- t84v (see paper)
34% identity, 90% coverage: 34:391/396 of query aligns to 31:400/402 of 5wmiA
Sites not aligning to the query:
5wmhA Arabidopsis thaliana prephenate aminotransferase (see paper)
33% identity, 89% coverage: 34:384/396 of query aligns to 31:394/399 of 5wmhA
5wmlA Arabidopsis thaliana prephenate aminotransferase mutant- k306a (see paper)
33% identity, 90% coverage: 34:391/396 of query aligns to 32:401/404 of 5wmlA
Sites not aligning to the query:
Q58097 (5-formylfuran-3-yl)methyl phosphate transaminase; 4-HFC-P:alanine aminotransferase; EC 2.6.1.108 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
31% identity, 95% coverage: 6:382/396 of query aligns to 2:364/370 of Q58097
8wkjA The crystal structure of aspartate aminotransferases lpg0070 from legionella pneumophila (see paper)
32% identity, 89% coverage: 33:384/396 of query aligns to 32:388/391 of 8wkjA
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
28% identity, 94% coverage: 22:393/396 of query aligns to 22:402/402 of P14909
Sites not aligning to the query:
>PP_3721 FitnessBrowser__Putida:PP_3721
MRYAKLTQRIAGDGAAAWDIHYRALALQAEDKDILLLSVGDPDFDTPAPIVEAAIDSLRA
GHTHYADVRGKLALRQAIANRHRQRSGQAVSADQVTVLAGAQCALYCVAQCILDPGDEVI
VAEPMYVTYEAVFGACGAKVVPVPVKPENGFRVCPRDVAERITPRTRALALNSPHNPSGA
SLPRATWEALAELCVAHDLWLISDEVYSELLYEGEHVSPGSLPGMAERTATLNSLSKSHA
MTGWRMGWVVGSTALATHLENLALCMLYGLPDFVQDAAVVALEHPLPELDAMREAYRQRR
DLVCEQLAGCPGLKALKPDGGMFVMLDIRETGVSAQAFADYLLDSQGVSVLAGEAFGPSA
AGHIRLGLVLGNEALVDACQRIARCAGELMRGQTDA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory