Comparing PP_3736 FitnessBrowser__Putida:PP_3736 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3gb4A Crystal structure of dicamba monooxygenase with non-heme cobalt and dicamba (see paper)
34% identity, 96% coverage: 2:342/355 of query aligns to 3:339/341 of 3gb4A
3gkeA Crystal structure of dicamba monooxygenase (see paper)
34% identity, 96% coverage: 2:342/355 of query aligns to 3:339/340 of 3gkeA
Q5S3I3 Dicamba O-demethylase, oxygenase component; Dicamba monooxygenase; DMO; Three-component Rieske non-heme iron oxygenase system; EC 1.14.15.- from Stenotrophomonas maltophilia (Pseudomonas maltophilia) (Xanthomonas maltophilia) (see 3 papers)
34% identity, 96% coverage: 2:342/355 of query aligns to 3:339/339 of Q5S3I3
Sites not aligning to the query:
3gobA Crystal structure of dicamba monooxygenase with non-heme cobalt and dcsa (see paper)
34% identity, 96% coverage: 2:342/355 of query aligns to 4:340/342 of 3gobA
3gkeB Crystal structure of dicamba monooxygenase (see paper)
33% identity, 96% coverage: 2:342/355 of query aligns to 3:333/334 of 3gkeB
6vshC Crystal structure of apo dicamba monooxygenase (see paper)
33% identity, 96% coverage: 2:342/355 of query aligns to 3:318/320 of 6vshC
7qwtA Rieske non-heme iron monooxygenase for guaiacol o-demethylation
28% identity, 95% coverage: 4:341/355 of query aligns to 8:343/352 of 7qwtA
7szeB Structure of the rieske non-heme iron oxygenase gxta with saxitoxin bound (see paper)
26% identity, 86% coverage: 5:310/355 of query aligns to 10:292/329 of 7szeB
7szfA Structure of the rieske non-heme iron oxygenase gxta with beta- saxitoxinol bound (see paper)
32% identity, 46% coverage: 5:168/355 of query aligns to 9:175/318 of 7szfA
Sites not aligning to the query:
7szgA Structure of the rieske non-heme iron oxygenase gxta pressurized with xenon (see paper)
32% identity, 46% coverage: 5:168/355 of query aligns to 8:174/315 of 7szgA
Sites not aligning to the query:
6wndA Structure of the rieske non-heme iron oxygenase gxta with dideoxysaxitoxin bound (see paper)
32% identity, 46% coverage: 5:168/355 of query aligns to 9:175/311 of 6wndA
Sites not aligning to the query:
6wn3B Structure of the rieske non-heme iron oxygenase sxtt (see paper)
31% identity, 46% coverage: 5:168/355 of query aligns to 10:176/328 of 6wn3B
Sites not aligning to the query:
7szhA Structure of the rieske non-heme iron oxygenase sxtt with beta- saxitoxinol bound (see paper)
31% identity, 46% coverage: 5:168/355 of query aligns to 8:174/323 of 7szhA
Sites not aligning to the query:
6wnbA Structure of the rieske non-heme iron oxygenase sxtt with dideoxysaxitoxin bound (see paper)
31% identity, 46% coverage: 5:168/355 of query aligns to 9:175/320 of 6wnbA
Sites not aligning to the query:
Q9MBA1 Chlorophyllide a oxygenase, chloroplastic; Chlorophyll a oxygenase; Chlorophyll b synthase; AtCAO; EC 1.14.13.122 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 92% coverage: 4:330/355 of query aligns to 218:519/536 of Q9MBA1
Sites not aligning to the query:
7fhrA Crystal structure of a rieske oxygenase from cupriavidus metallidurans (see paper)
28% identity, 41% coverage: 19:162/355 of query aligns to 42:188/437 of 7fhrA
Sites not aligning to the query:
P95483 Aminopyrrolnitrin oxygenase PrnD; Arylamine oxygenase; EC 1.14.13.- from Pseudomonas fluorescens (see 2 papers)
29% identity, 46% coverage: 6:170/355 of query aligns to 28:200/363 of P95483
Sites not aligning to the query:
4qckA Crystal structure of 3-ketosteroid-9-alpha-hydroxylase (ksha) from m. Tuberculosis in complex with 4-androstene-3,17-dione (see paper)
21% identity, 96% coverage: 9:348/355 of query aligns to 16:328/355 of 4qckA
F1CMX0 3-ketosteroid-9-alpha-monooxygenase, oxygenase component; 3-ketosteroid-9-alpha-hydroxylase, oxygenase component; KSH; Androsta-1,4-diene-3,17-dione 9-alpha-hydroxylase; Rieske-type oxygenase; RO; EC 1.14.15.30 from Rhodococcus rhodochrous (see paper)
28% identity, 41% coverage: 19:163/355 of query aligns to 40:188/394 of F1CMX0
Sites not aligning to the query:
P71875 3-ketosteroid-9-alpha-monooxygenase, oxygenase component; 3-ketosteroid-9-alpha-hydroxylase, oxygenase component; KSH; Androsta-1,4-diene-3,17-dione 9-alpha-hydroxylase; Rieske-type oxygenase; RO; EC 1.14.15.30 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
21% identity, 96% coverage: 9:348/355 of query aligns to 29:348/386 of P71875
>PP_3736 FitnessBrowser__Putida:PP_3736
MYPKNTWYVACTPDEIATKPLGRQICGEKIVFYRARENQVAAVEDFCPHRGAPLSLGYVE
DGNLVCGYHGLVMGCDGKTVSMPGQRVRGFPCNKTFAAVERYGFIWVWPGDQAQADPALI
PHLEWAVSDEWAYGGGLFHIGCDYRLMIDNLMDLTHETYVHASSIGQKEIDEAPPVTTVT
GDEVVTARHMENIMAPPFWRMALRGNGLADDVPVDRWQICRFTPPSHVLIEVGVAHAGKG
GYHAEAQHKASSIVVDFITPESDTSIWYFWGMARNFAAHDQTLTDNIREGQGKIFSEDLE
MLERQQQNLLAHPERNLLKLNIDAGGVQSRKVLERIIAQERAPQPQLIATSANPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory