SitesBLAST
Comparing PP_3745 PP_3745 glycolate oxidase, putative FAD-linked subunit to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
30% identity, 91% coverage: 19:470/499 of query aligns to 8:462/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ A84), G75 (= G86), S76 (≠ A87), G77 (= G88), T78 (= T89), G79 (= G90), L80 (= L91), A83 (≠ G94), C84 (≠ A95), P137 (= P148), G138 (≠ S149), E139 (≠ S150), A142 (= A153), T143 (≠ S155), G146 (= G158), N147 (= N159), S149 (≠ A161), T150 (≠ E162), A152 (= A164), G153 (= G165), E203 (= E214), G204 (= G215), I209 (≠ V220), E422 (= E430), H423 (= H431)
- binding fe (iii) ion: H377 (= H386), H384 (= H393), E422 (= E430)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 83% coverage: 56:469/499 of query aligns to 40:453/459 of P9WIT1
- K354 (≠ R365) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
29% identity, 83% coverage: 56:470/499 of query aligns to 40:453/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R337), W322 (≠ F341), H369 (= H386), H376 (= H393), H414 (= H431)
- binding flavin-adenine dinucleotide: P68 (≠ A84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (= G90), G78 (= G94), V79 (≠ A95), L90 (≠ M106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (= A161), T144 (≠ E162), A146 (= A164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (≠ V220), W322 (≠ F341), E413 (= E430), N450 (= N467)
- binding manganese (ii) ion: H369 (= H386), H376 (= H393), E413 (= E430)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
29% identity, 83% coverage: 56:470/499 of query aligns to 40:453/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (≠ A84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (= G90), G78 (= G94), V79 (≠ A95), L90 (≠ M106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (= A161), T144 (≠ E162), A146 (= A164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (≠ V220), W322 (≠ F341), E413 (= E430), H414 (= H431), N450 (= N467)
- binding lactic acid: R318 (= R337), H369 (= H386), H376 (= H393), H414 (= H431)
- binding manganese (ii) ion: H369 (= H386), H376 (= H393), E413 (= E430)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
29% identity, 83% coverage: 56:470/499 of query aligns to 40:454/456 of 8jdsA
- binding flavin-adenine dinucleotide: P68 (≠ A84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (= G90), G78 (= G94), V79 (≠ A95), L90 (≠ M106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (= A161), T144 (≠ E162), A146 (= A164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (≠ V220), W323 (≠ F341), E414 (= E430), H415 (= H431), N451 (= N467)
- binding manganese (ii) ion: H370 (= H386), H377 (= H393), E414 (= E430)
- binding pyruvic acid: R319 (= R337), H370 (= H386), H377 (= H393), H415 (= H431)
Sites not aligning to the query:
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
29% identity, 83% coverage: 56:470/499 of query aligns to 40:453/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R337), H369 (= H386), H376 (= H393), H414 (= H431)
- binding flavin-adenine dinucleotide: P68 (≠ A84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (= G90), G78 (= G94), V79 (≠ A95), L90 (≠ M106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (= A161), T144 (≠ E162), A146 (= A164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (≠ V220), W322 (≠ F341), E413 (= E430), H414 (= H431), N450 (= N467)
- binding manganese (ii) ion: H369 (= H386), H376 (= H393), E413 (= E430)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
29% identity, 83% coverage: 56:470/499 of query aligns to 40:452/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L91), R317 (= R337), W321 (≠ F341), H368 (= H386), H375 (= H393), H413 (= H431)
- binding flavin-adenine dinucleotide: P68 (≠ A84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (= G90), G78 (= G94), V79 (≠ A95), L90 (≠ M106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (= A161), T144 (≠ E162), A146 (= A164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (≠ V220), W321 (≠ F341), Y322 (≠ P342), E412 (= E430), H413 (= H431), N449 (= N467)
- binding manganese (ii) ion: H368 (= H386), H375 (= H393), E412 (= E430)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
29% identity, 83% coverage: 56:470/499 of query aligns to 40:453/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (≠ A84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (= G90), G78 (= G94), V79 (≠ A95), L90 (≠ M106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (= A161), T144 (≠ E162), A146 (= A164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (≠ V220), H369 (= H386), E413 (= E430), N450 (= N467)
- binding deaminohydroxyvaline: R319 (= R337), H414 (= H431)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
29% identity, 83% coverage: 56:470/499 of query aligns to 40:454/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (≠ A84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (= G90), G78 (= G94), V79 (≠ A95), L90 (≠ M106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (= A161), T144 (≠ E162), A146 (= A164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (≠ V220), Y324 (≠ P342), H370 (= H386), E414 (= E430), N451 (= N467)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R337), W323 (≠ F341), H415 (= H431)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
29% identity, 83% coverage: 56:470/499 of query aligns to 40:454/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R337), W323 (≠ F341), H370 (= H386), H415 (= H431)
- binding flavin-adenine dinucleotide: P68 (≠ A84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (= G90), G78 (= G94), V79 (≠ A95), L90 (≠ M106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (= A161), T144 (≠ E162), A146 (= A164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (≠ V220), H370 (= H386), E414 (= E430), N451 (= N467)
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
29% identity, 83% coverage: 56:470/499 of query aligns to 40:454/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R337), W323 (≠ F341), H415 (= H431)
- binding flavin-adenine dinucleotide: P68 (≠ A84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (= G90), G78 (= G94), V79 (≠ A95), L90 (≠ M106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (= A161), T144 (≠ E162), A146 (= A164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (≠ V220), Y324 (≠ P342), H370 (= H386), E414 (= E430), N451 (= N467)
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
29% identity, 83% coverage: 56:470/499 of query aligns to 40:454/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (≠ A84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (= G90), G78 (= G94), V79 (≠ A95), L90 (≠ M106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (= A161), T144 (≠ E162), A146 (= A164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (≠ V220), H370 (= H386), E414 (= E430), N451 (= N467)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R337), W323 (≠ F341), H415 (= H431)
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
29% identity, 83% coverage: 56:470/499 of query aligns to 40:454/456 of 8jdgA
- binding flavin-adenine dinucleotide: P68 (≠ A84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (= G90), G78 (= G94), V79 (≠ A95), L90 (≠ M106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (= A161), T144 (≠ E162), A146 (= A164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (≠ V220), H370 (= H386), E414 (= E430), N451 (= N467)
- binding (2R)-2-oxidanylbutanoic acid: R319 (= R337), H415 (= H431)
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
29% identity, 83% coverage: 56:470/499 of query aligns to 40:454/456 of 8jdbA
- binding flavin-adenine dinucleotide: P68 (≠ A84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (= G90), G78 (= G94), V79 (≠ A95), L90 (≠ M106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (= A161), T144 (≠ E162), A146 (= A164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (≠ V220), Y324 (≠ P342), H370 (= H386), E414 (= E430), N451 (= N467)
- binding (2R)-2-oxidanyloctanoic acid: V75 (≠ L91), R319 (= R337), W323 (≠ F341), H415 (= H431)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
29% identity, 83% coverage: 56:470/499 of query aligns to 40:453/455 of 8jdxA
- binding flavin-adenine dinucleotide: P68 (≠ A84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (= G90), G78 (= G94), V79 (≠ A95), L90 (≠ M106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (= A161), T144 (≠ E162), A146 (= A164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (≠ V220), W322 (≠ F341), E413 (= E430), H414 (= H431), N450 (= N467)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R337), H369 (= H386), H376 (= H393), H414 (= H431)
- binding manganese (ii) ion: H369 (= H386), H376 (= H393), E413 (= E430)
Sites not aligning to the query:
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
29% identity, 83% coverage: 56:470/499 of query aligns to 40:452/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R337), W322 (≠ F341), H369 (= H386), H376 (= H393), H413 (= H431)
- binding flavin-adenine dinucleotide: P68 (≠ A84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (= G90), G78 (= G94), V79 (≠ A95), L90 (≠ M106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (= A161), T144 (≠ E162), A146 (= A164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (≠ V220), W322 (≠ F341), E412 (= E430), H413 (= H431), N449 (= N467)
- binding manganese (ii) ion: H369 (= H386), H376 (= H393), E412 (= E430)
Sites not aligning to the query:
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
29% identity, 83% coverage: 56:470/499 of query aligns to 40:452/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R337), W322 (≠ F341), S336 (≠ C353), H369 (= H386), H376 (= H393), H413 (= H431)
- binding flavin-adenine dinucleotide: P68 (≠ A84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (= G90), G78 (= G94), V79 (≠ A95), L90 (≠ M106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (= A161), T144 (≠ E162), A146 (= A164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (≠ V220), E412 (= E430), N449 (= N467)
- binding manganese (ii) ion: H369 (= H386), H376 (= H393), E412 (= E430)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
30% identity, 87% coverage: 39:474/499 of query aligns to 31:467/467 of 6lpnB
- binding flavin-adenine dinucleotide: W40 (≠ G48), P76 (≠ A84), G78 (= G86), G79 (≠ A87), N80 (≠ G88), T81 (= T89), G82 (= G90), M83 (≠ L91), G86 (= G94), S87 (≠ A95), L140 (≠ P148), A142 (≠ S150), C146 (= C154), H147 (≠ S155), G150 (= G158), N151 (= N159), A153 (= A161), T154 (≠ E162), G208 (= G215), I212 (= I219), I213 (≠ V220), E423 (= E430), N460 (= N467)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
30% identity, 87% coverage: 39:474/499 of query aligns to 30:466/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R337), T337 (≠ F341), K348 (≠ C353), Y379 (vs. gap), H381 (= H386), H388 (= H393), H423 (= H431)
- binding flavin-adenine dinucleotide: W39 (≠ G48), P75 (≠ A84), Q76 (≠ R85), G77 (= G86), G78 (≠ A87), N79 (≠ G88), T80 (= T89), G81 (= G90), M82 (≠ L91), G85 (= G94), S86 (≠ A95), L139 (≠ P148), G140 (≠ S149), A141 (≠ S150), C145 (= C154), G149 (= G158), N150 (= N159), A152 (= A161), T153 (≠ E162), G157 (= G166), G207 (= G215), I212 (≠ V220), E422 (= E430), N459 (= N467)
- binding zinc ion: H381 (= H386), H388 (= H393), E422 (= E430)
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
30% identity, 87% coverage: 39:474/499 of query aligns to 30:466/466 of 6lpuA
- binding flavin-adenine dinucleotide: W39 (≠ G48), P75 (≠ A84), G77 (= G86), G78 (≠ A87), N79 (≠ G88), T80 (= T89), G81 (= G90), G85 (= G94), S86 (≠ A95), L139 (≠ P148), G140 (≠ S149), A141 (≠ S150), C145 (= C154), H146 (≠ S155), G148 (= G157), G149 (= G158), N150 (= N159), A152 (= A161), T153 (≠ E162), A155 (= A164), E206 (= E214), G207 (= G215), I211 (= I219), I212 (≠ V220), E422 (= E430), N459 (= N467)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R337), T337 (≠ F341), K348 (≠ C353), Y379 (vs. gap), H381 (= H386), H388 (= H393), H423 (= H431)
- binding zinc ion: H381 (= H386), H388 (= H393), E422 (= E430)
Query Sequence
>PP_3745 PP_3745 glycolate oxidase, putative FAD-linked subunit
MNILYDERVDGALPNVDLAALLQALRDALPDLEILHRDEDLKPYECDGLSAYRTVPLLVA
LPERLEQVQTLLKLCHQRGVPVVARGAGTGLSGGALPLAKGILLVMARFNRILEVNPQGR
YARVQPGVRNLAISQAAAPHGMYYAPDPSSQIACSIGGNVAENAGGVHCLKYGLTVHNVL
KVDILTVEGERLSLGSDALDSPGFDLLALFIGSEGMLGIVTEVTVKLLPKPQVARVILAS
FDSVEDAGRAVADIIAAGIIPGGLEMMDNLAIRAAEDFIHAGYPVDAAAILLCELDGVEA
DVYDDCERVAAVLTQAGAREVHLACDEAERARFWAGRKNAFPAVGRISPDYYCMDGTIPR
RELPRVLKGISDLSAEYGLRVANVFHAGDGNMHPLILFDANLPGELERAEAIGGKILELC
VKVGGSITGEHGVGREKINQMCAQFNSDEITLFHAVKAAFDPQGLLNPGKNIPTLHRCAE
FGALHVHQGQLPFPELERF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory