SitesBLAST
Comparing PP_3766 FitnessBrowser__Putida:PP_3766 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6l0uB Crystal structure of mouse glyoxalase i complexed with a small molecule inhibitor
55% identity, 95% coverage: 7:173/175 of query aligns to 7:173/177 of 6l0uB
- active site: Q27 (≠ H27), E93 (= E93), H120 (= H120), E166 (= E166)
- binding N-[4-(trifluoromethyloxy)phenyl]-1,3,4,9-tetrahydropyrido[3,4-b]indole-2-carbothioamide: R116 (= R116), K144 (= K144), D148 (= D148), G149 (= G149), W164 (= W164)
- binding zinc ion: Q27 (≠ H27), E93 (= E93), H120 (= H120), E166 (= E166)
4kykB Crystal structure of mouse glyoxalase i complexed with indomethacin (see paper)
55% identity, 95% coverage: 7:173/175 of query aligns to 7:173/177 of 4kykB
- active site: Q27 (≠ H27), E93 (= E93), H120 (= H120), E166 (= E166)
- binding indomethacin: K144 (= K144), K150 (≠ R150), M151 (= M151), L154 (= L154), F156 (= F156)
- binding zinc ion: Q27 (≠ H27), E93 (= E93), H120 (= H120), E166 (= E166)
4kyhA Crystal structure of mouse glyoxalase i complexed with zopolrestat (see paper)
55% identity, 95% coverage: 7:173/175 of query aligns to 9:175/177 of 4kyhA
- active site: Q29 (≠ H27), E95 (= E93), H122 (= H120), E168 (= E166)
- binding zinc ion: Q29 (≠ H27), E95 (= E93), H122 (= H120), E168 (= E166)
- binding 3,4-dihydro-4-oxo-3-((5-trifluoromethyl-2-benzothiazolyl)methyl)-1-phthalazine acetic acid: M31 (= M29), R33 (= R31), F63 (= F61), E95 (= E93), T97 (= T95), N99 (= N97)
Q9CPU0 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Mus musculus (Mouse) (see paper)
55% identity, 95% coverage: 7:173/175 of query aligns to 14:180/184 of Q9CPU0
- Q34 (≠ H27) binding
- E100 (= E93) binding
- H127 (= H120) binding in other chain
- E173 (= E166) binding in other chain
4opnA Crystal structure of mouse glyoxalase i complexed with mah
55% identity, 95% coverage: 7:173/175 of query aligns to 6:172/172 of 4opnA
- active site: Q26 (≠ H27), E92 (= E93), H119 (= H120), E165 (= E166)
- binding L-gamma-glutamyl-N-(3-ethynylphenyl)-N-hydroxy-L-glutaminylglycine: Q26 (≠ H27), R30 (= R31), F60 (= F61), F85 (≠ K86), E92 (= E93), T94 (= T95), N96 (= N97), R115 (= R116), H119 (= H120), K143 (= K144), K149 (≠ R150), M150 (= M151), L153 (= L154), E165 (= E166), I172 (≠ L173)
- binding zinc ion: Q26 (≠ H27), E92 (= E93)
4kykA Crystal structure of mouse glyoxalase i complexed with indomethacin (see paper)
55% identity, 95% coverage: 7:173/175 of query aligns to 9:175/179 of 4kykA
2za0A Crystal structure of mouse glyoxalase i complexed with methyl-gerfelin (see paper)
55% identity, 95% coverage: 7:173/175 of query aligns to 11:177/180 of 2za0A
- active site: Q31 (≠ H27), E97 (= E93), H124 (= H120), E170 (= E166)
- binding methyl 4-(2,3-dihydroxy-5-methylphenoxy)-2-hydroxy-6-methylbenzoate: Q31 (≠ H27), F65 (= F61), L67 (= L63), F90 (≠ K86), E97 (= E93), H124 (= H120), M155 (= M151), E170 (= E166)
- binding zinc ion: Q31 (≠ H27), E97 (= E93), H124 (= H120), E170 (= E166)
4pv5A Crystal structure of mouse glyoxalase i in complexed with 18-beta- glycyrrhetinic acid (see paper)
55% identity, 95% coverage: 7:173/175 of query aligns to 2:168/170 of 4pv5A
4x2aA Crystal structure of mouse glyoxalase i complexed with baicalein (see paper)
56% identity, 93% coverage: 11:173/175 of query aligns to 4:166/167 of 4x2aA
- active site: Q20 (≠ H27), E86 (= E93), H113 (= H120), E159 (= E166)
- binding 5,6,7-trihydroxy-2-phenyl-4H-chromen-4-one: Q20 (≠ H27), F49 (= F56), L56 (= L63), F79 (≠ K86), E86 (= E93), H113 (= H120), M144 (= M151), E159 (= E166), I166 (≠ L173)
- binding zinc ion: Q20 (≠ H27), E86 (= E93), H113 (= H120), E159 (= E166)
Sites not aligning to the query:
3w0tA Human glyoxalase i with an n-hydroxypyridone derivative inhibitor
56% identity, 93% coverage: 12:173/175 of query aligns to 11:172/176 of 3w0tA
- active site: Q26 (≠ H27), E92 (= E93), H119 (= H120), E165 (= E166)
- binding N-[3-(1-hydroxy-6-oxo-4-phenyl-1,6-dihydropyridin-2-yl)phenyl]methanesulfonamide: Q26 (≠ H27), F55 (= F56), F60 (= F61), L62 (= L63), F64 (= F65), E92 (= E93), H119 (= H120), E165 (= E166), M172 (≠ L173)
- binding zinc ion: Q26 (≠ H27), E92 (= E93), H119 (= H120), E165 (= E166)
Sites not aligning to the query:
3vw9A Human glyoxalase i with an n-hydroxypyridone inhibitor (see paper)
56% identity, 93% coverage: 12:173/175 of query aligns to 11:172/176 of 3vw9A
- active site: Q26 (≠ H27), E92 (= E93), H119 (= H120), E165 (= E166)
- binding 1-hydroxy-6-[1-(3-methoxypropyl)-1H-pyrrolo[2,3-b]pyridin-5-yl]-4-phenylpyridin-2(1H)-one: Q26 (≠ H27), C53 (≠ R54), L62 (= L63), E92 (= E93), H119 (= H120), M150 (= M151), F155 (= F156), E165 (= E166), M172 (≠ L173)
- binding zinc ion: Q26 (≠ H27), E92 (= E93), H119 (= H120), E165 (= E166)
Sites not aligning to the query:
1qipA Human glyoxalase i complexed with s-p- nitrobenzyloxycarbonylglutathione (see paper)
56% identity, 93% coverage: 12:173/175 of query aligns to 11:172/176 of 1qipA
- active site: Q26 (≠ H27), E92 (= E93), H119 (= H120), E165 (= E166)
- binding s-p-nitrobenzyloxycarbonylglutathione: R30 (= R31), Q51 (≠ D52), C53 (≠ R54), F60 (= F61), F64 (= F65), I81 (≠ H82), L85 (≠ K86), T94 (= T95), N96 (= N97), R115 (= R116), M150 (= M151), F155 (= F156), M172 (≠ L173)
- binding zinc ion: Q26 (≠ H27), E92 (= E93), H119 (= H120), E165 (= E166)
1qinA Human glyoxalase i complexed with s-(n-hydroxy-n-p- iodophenylcarbamoyl) glutathione (see paper)
56% identity, 93% coverage: 12:173/175 of query aligns to 11:172/176 of 1qinA
- active site: Q26 (≠ H27), E92 (= E93), H119 (= H120), E165 (= E166)
- binding s-(n-hydroxy-n-iodophenylcarbamoyl)glutathione: Q26 (≠ H27), R30 (= R31), F60 (= F61), L62 (= L63), F64 (= F65), E92 (= E93), T94 (= T95), N96 (= N97), R115 (= R116), H119 (= H120), K143 (= K144), G148 (= G149), K149 (≠ R150), M150 (= M151), E165 (= E166), M172 (≠ L173)
- binding zinc ion: Q26 (≠ H27), E92 (= E93)
1froA Human glyoxalase i with benzyl-glutathione inhibitor (see paper)
56% identity, 93% coverage: 12:173/175 of query aligns to 11:172/176 of 1froA
- active site: Q26 (≠ H27), E92 (= E93), H119 (= H120), E165 (= E166)
- binding s-benzyl-glutathione: R30 (= R31), F60 (= F61), T94 (= T95), N96 (= N97), R115 (= R116), M150 (= M151), F155 (= F156), E165 (= E166)
- binding zinc ion: Q26 (≠ H27), E92 (= E93), H119 (= H120), E165 (= E166)
Sites not aligning to the query:
3w0uA Human glyoxalase i with an n-hydroxypyridone inhibitor
56% identity, 93% coverage: 12:173/175 of query aligns to 11:172/175 of 3w0uA
- active site: Q26 (≠ H27), E92 (= E93), H119 (= H120), E165 (= E166)
- binding N-[3-(1-Hydroxy-6-oxo-4-phenyl-1,6-dihydro-pyridin-2-yl)-5-methanesulfonylamino-phenyl]-methanesulfonamide: Q26 (≠ H27), F60 (= F61), L62 (= L63), E92 (= E93), H119 (= H120), K143 (= K144), M150 (= M151), E165 (= E166), M172 (≠ L173)
- binding zinc ion: Q26 (≠ H27), E92 (= E93), H119 (= H120), E165 (= E166)
7wt0A Human glyoxalase i (with c-ter his tag) in complex with tlsc702 (see paper)
57% identity, 90% coverage: 17:173/175 of query aligns to 23:179/185 of 7wt0A
- binding (~{E})-3-(1,3-benzothiazol-2-yl)-4-(4-methoxyphenyl)but-3-enoic acid: C60 (≠ R54), F62 (= F56), L69 (= L63), F71 (= F65), L92 (≠ K86), E99 (= E93), H126 (= H120), K150 (= K144), M157 (= M151), L160 (= L154), F162 (= F156), E172 (= E166), M179 (≠ L173)
- binding zinc ion: Q33 (≠ H27), E99 (= E93), H126 (= H120), E172 (= E166)
Sites not aligning to the query:
Q04760 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Homo sapiens (Human) (see 12 papers)
57% identity, 90% coverage: 17:173/175 of query aligns to 24:180/184 of Q04760
- Q34 (≠ H27) binding ; mutation to E: Reduces enzyme activity by 99%.
- S45 (= S38) mutation to A: No effect on phosphorylation.
- C61 (≠ R54) modified: Disulfide link with 139, Alternate; mutation to A: No effect on NO-mediated modification.
- S69 (= S62) mutation to A: No effect on phosphorylation.
- S94 (= S87) mutation to A: No effect on phosphorylation.
- T98 (≠ V91) mutation to A: No effect on phosphorylation.
- E100 (= E93) binding ; mutation to Q: Reduces enzyme activity by over 99%.
- T102 (= T95) mutation to A: No effect on phosphorylation.
- T107 (= T100) modified: Phosphothreonine; mutation to A: Loss of phosphorylation.
- E111 (≠ A104) to A: in dbSNP:rs4746
- H127 (= H120) binding in other chain
- C139 (= C132) modified: S-glutathionyl cysteine; alternate; modified: Disulfide link with 61, Alternate; mutation to A: Impaired NO-mediated modification. Loss of NO-mediated modification; when associated with A-19 or A-20.
- E173 (= E166) active site, Proton donor/acceptor; binding in other chain; mutation to Q: Abolishes enzyme activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 19 modified: Disulfide link with 20; C → Y: in dbSNP:rs17855424; C→A: No effect on NO-mediated modification. Impaired NO-mediated modification; when associated with A-20. Loss of NO-mediated modification; when associated with A-139.
- 20 modified: Disulfide link with 19; C→A: No effect on NO-mediated modification. Impaired NO-mediated modification; when associated with A-19. Loss of NO-mediated modification; when associated with A-139.
7wszA Human glyoxalase i (with c-ter his tag) in glycerol-bound form (see paper)
56% identity, 93% coverage: 12:173/175 of query aligns to 11:172/183 of 7wszA
Sites not aligning to the query:
1bh5A Human glyoxalase i q33e, e172q double mutant (see paper)
55% identity, 93% coverage: 12:173/175 of query aligns to 12:173/177 of 1bh5A
- active site: E27 (≠ H27), E93 (= E93), H120 (= H120), Q166 (≠ E166)
- binding s-hexylglutathione: R31 (= R31), F61 (= F61), L63 (= L63), T95 (= T95), N97 (= N97), R116 (= R116), M151 (= M151), F156 (= F156)
- binding zinc ion: E27 (≠ H27), E93 (= E93), H120 (= H120), Q166 (≠ E166)
P50107 Glyoxalase I; Glx I; Aldoketomutase; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; actoylglutathione lyase; EC 4.4.1.5 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
47% identity, 83% coverage: 23:168/175 of query aligns to 21:165/326 of P50107
- E163 (= E166) active site, Proton donor/acceptor
Sites not aligning to the query:
- 318 active site, Proton donor/acceptor
Query Sequence
>PP_3766 FitnessBrowser__Putida:PP_3766
MSLHDLQTLPGVTAQPDAATAQFVFNHTMLRVKDIEKSLDFYTRVLGFRLVDKRDFPEAA
FSLYFLALVDPAQIPADDTARHQWMKSIPGVLELTHNHGTENDADFAYHNGNTDPRGFGH
ICISVPDVRAACARFEELEVPFQKRLQDGRMNHLAFVKDPDGYWVEVIQPTELEG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory