Comparing PP_3768 FitnessBrowser__Putida:PP_3768 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P44774 Shikimate dehydrogenase-like protein HI_0607; SDH-L; EC 1.1.1.25 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see paper)
54% identity, 97% coverage: 6:271/273 of query aligns to 3:268/271 of P44774
1o9bA Quinate/shikimate dehydrogenase ydib complexed with nadh (see paper)
30% identity, 90% coverage: 25:269/273 of query aligns to 18:280/280 of 1o9bA
1npdB X-ray structure of shikimate dehydrogenase complexed with NAD+ from e.Coli (ydib) northeast structural genomics research consortium (nesg) target er24 (see paper)
30% identity, 90% coverage: 25:269/273 of query aligns to 24:286/288 of 1npdB
P0A6D5 Quinate/shikimate dehydrogenase; NAD-dependent shikimate 5-dehydrogenase; EC 1.1.1.282 from Escherichia coli (strain K12) (see 4 papers)
30% identity, 90% coverage: 25:269/273 of query aligns to 24:286/288 of P0A6D5
Sites not aligning to the query:
6hqvA Pentafunctional arom complex from chaetomium thermophilum (see paper)
30% identity, 89% coverage: 26:267/273 of query aligns to 1282:1548/1555 of 6hqvA
Sites not aligning to the query:
2hk9A Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
28% identity, 84% coverage: 26:255/273 of query aligns to 24:252/269 of 2hk9A
Sites not aligning to the query:
2hk9B Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
28% identity, 84% coverage: 26:255/273 of query aligns to 24:252/267 of 2hk9B
Sites not aligning to the query:
O67049 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Aquifex aeolicus (strain VF5) (see paper)
28% identity, 84% coverage: 26:255/273 of query aligns to 24:252/269 of O67049
Sites not aligning to the query:
Q58484 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
27% identity, 94% coverage: 12:267/273 of query aligns to 8:276/282 of Q58484
1nvtB Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with NADP+ (see paper)
27% identity, 94% coverage: 12:267/273 of query aligns to 13:281/287 of 1nvtB
1nvtA Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with NADP+ (see paper)
27% identity, 94% coverage: 12:267/273 of query aligns to 13:281/287 of 1nvtA
2cy0A Crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with NADP (see paper)
33% identity, 85% coverage: 26:258/273 of query aligns to 19:248/262 of 2cy0A
2ev9B Crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with NADP(h) and shikimate (see paper)
33% identity, 85% coverage: 26:258/273 of query aligns to 19:248/263 of 2ev9B
Sites not aligning to the query:
Q5SJF8 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
33% identity, 85% coverage: 26:258/273 of query aligns to 19:248/263 of Q5SJF8
Sites not aligning to the query:
Q8ZPR4 Quinate/shikimate dehydrogenase; NAD-dependent shikimate 5-dehydrogenase; EC 1.1.1.282 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
28% identity, 85% coverage: 25:255/273 of query aligns to 24:272/288 of Q8ZPR4
2gptA Crystal structure of arabidopsis dehydroquinate dehydratase-shikimate dehydrogenase in complex with tartrate and shikimate (see paper)
29% identity, 86% coverage: 27:261/273 of query aligns to 253:480/498 of 2gptA
Sites not aligning to the query:
6bmqA Crystal structure of arabidopsis dehydroquinate dehydratase-shikimate dehydrogenase (t381g mutant) in complex with tartrate and shikimate (see paper)
29% identity, 86% coverage: 27:261/273 of query aligns to 253:480/498 of 6bmqA
Sites not aligning to the query:
2o7qA Crystal structure of the a. Thaliana dhq-dehydroshikimate-sdh- shikimate-NADP(h)
28% identity, 86% coverage: 27:261/273 of query aligns to 253:483/501 of 2o7qA
Sites not aligning to the query:
3tozA 2.2 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with NAD.
28% identity, 84% coverage: 26:254/273 of query aligns to 31:277/291 of 3tozA
Q8Y9N5 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
28% identity, 84% coverage: 26:254/273 of query aligns to 31:277/291 of Q8Y9N5
Sites not aligning to the query:
>PP_3768 FitnessBrowser__Putida:PP_3768
MPTTPSRDTVLCISLAGRPGTFGVRFHNHLYQQLGLDFYYKAMRTDDLPAAVAGIRALGI
RGCGVSMPYKEACMALVDEIDPSAAAIESVNTLVNCNGHLKAYNTDYLAVRQLLAQHQVD
PGTAFALRGSGGMAKAVASALRDAGFAEGIIVARNEQAGRQLADVCGYRWVPEPGDICPP
MLVNVTPIGMAGGLEAEELAFPEHAIAAAERVFDVVAMPAQTPLIRRAQALGKPVITGLE
VIALQALEQFVLYTGVRPTREQVDAAVAYARAT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory