Comparing PP_3778 FitnessBrowser__Putida:PP_3778 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3triA Structure of a pyrroline-5-carboxylate reductase (proc) from coxiella burnetii (see paper)
32% identity, 99% coverage: 4:264/264 of query aligns to 5:269/272 of 3triA
2ag8A NADP complex of pyrroline-5-carboxylate reductase from neisseria meningitidis (see paper)
30% identity, 98% coverage: 3:262/264 of query aligns to 2:258/263 of 2ag8A
5bshA Crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr) in complex with l-proline (see paper)
32% identity, 98% coverage: 3:262/264 of query aligns to 10:271/272 of 5bshA
5bsgA Crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr) in complex with NADP+ (see paper)
32% identity, 98% coverage: 3:262/264 of query aligns to 10:271/272 of 5bsgA
5bsfA Crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr) in complex with NAD+ (see paper)
32% identity, 98% coverage: 3:262/264 of query aligns to 10:271/272 of 5bsfA
5bseA Crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr) (see paper)
32% identity, 98% coverage: 3:262/264 of query aligns to 10:271/272 of 5bseA
2rcyA Crystal structure of plasmodium falciparum pyrroline carboxylate reductase (mal13p1.284) with NADP bound
28% identity, 77% coverage: 61:263/264 of query aligns to 60:261/262 of 2rcyA
Sites not aligning to the query:
8tcyA Structure of pycr1 complexed with 7-fluoro-2-oxo-1,2,3,4- tetrahydroquinoline-6-carboxylic acid (see paper)
28% identity, 98% coverage: 3:262/264 of query aligns to 9:275/281 of 8tcyA
8tcwA Structure of pycr1 complexed with 2-methyl-3-(2-oxoimidazolidin-1-yl) benzoic acid (see paper)
28% identity, 98% coverage: 3:262/264 of query aligns to 9:275/282 of 8tcwA
8td1A Structure of pycr1 complexed with 3-(6-oxa-9-azaspiro(4.5)decane-9- carbonyl)benzoic acid (see paper)
28% identity, 98% coverage: 3:262/264 of query aligns to 9:275/280 of 8td1A
8td0A Structure of pycr1 complexed with 5-oxo-7a-phenyl-hexahydropyrrolo[2, 1-b][1,3]thiazole-3-carboxylic acid (see paper)
28% identity, 98% coverage: 3:262/264 of query aligns to 9:275/280 of 8td0A
8tczA Structure of pycr1 complexed with 2-(pyridin-2-yl)cyclopropane-1- carboxylic acid (see paper)
28% identity, 98% coverage: 3:262/264 of query aligns to 9:275/280 of 8tczA
8tcxA Structure of pycr1 complexed with 2,4-dioxo-1,2,3,4- tetrahydroquinazoline-6-carboxylic acid (see paper)
28% identity, 98% coverage: 3:262/264 of query aligns to 9:275/280 of 8tcxA
2izzA Crystal structure of human pyrroline-5-carboxylate reductase
29% identity, 98% coverage: 3:262/264 of query aligns to 3:269/272 of 2izzA
8tcuA Structure of pycr1 complexed with 2-chloro-5-(2-oxoimidazolidin-1-yl) benzoic acid (see paper)
28% identity, 98% coverage: 3:262/264 of query aligns to 9:275/279 of 8tcuA
2graA Crystal structure of human pyrroline-5-carboxylate reductase complexed with NADP (see paper)
28% identity, 98% coverage: 3:262/264 of query aligns to 4:270/277 of 2graA
2gr9A Crystal structure of p5cr complexed with nadh (see paper)
28% identity, 98% coverage: 3:262/264 of query aligns to 4:270/277 of 2gr9A
8tcvB Structure of pycr1 complexed with 4-bromobenzene-1,3-dicarboxylic acid (see paper)
28% identity, 98% coverage: 3:262/264 of query aligns to 8:274/279 of 8tcvB
5uavA Structure of human pycr-1 complexed with NADPH and l-tetrahydrofuroic acid (see paper)
28% identity, 98% coverage: 3:262/264 of query aligns to 6:272/278 of 5uavA
6xp3A Structure of human pycr1 complexed with cyclopentanecarboxylic acid (see paper)
28% identity, 98% coverage: 3:262/264 of query aligns to 5:271/276 of 6xp3A
>PP_3778 FitnessBrowser__Putida:PP_3778
MKTIYMVGAGHMGGAILLGLKAYFKSATDLRVIEIDTQRSNDWRAKGFETSSRIQTLQPQ
DCVVLAVPPQQFENMLAANPVLCRHRGPVVSVMAGITHATLVRLLGHDAVVRAIPNTPSE
VAQGVTMYYAPSDADAALIDSARQIFDVIGLSLRVNDERQIDTGTALAGGGPALVAHFAD
ALQDYGLHMGLDSEQAAVVALQLLSGTAALIQASGKPASQICQEVQTAGGTTERAIRALD
AAGFKGLVNAALDAAARRSAELGQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory