SitesBLAST
Comparing PP_3827 FitnessBrowser__Putida:PP_3827 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5lsmA Crystal structure of nitronate monooxygenase (so_0471) from shewanella oneidensis mr-1
55% identity, 94% coverage: 8:348/361 of query aligns to 2:334/339 of 5lsmA
- binding flavin mononucleotide: A16 (= A22), P17 (= P23), M18 (= M24), A19 (= A25), N67 (= N74), H123 (= H137), A170 (= A184), G171 (= G185), G207 (= G221), G208 (= G222), G229 (= G243), T230 (= T244), W314 (= W328)
4q4kA Crystal structure of nitronate monooxygenase from pseudomonas aeruginosa pao1 (see paper)
43% identity, 94% coverage: 8:348/361 of query aligns to 4:345/351 of 4q4kA
- binding flavin mononucleotide: A18 (= A22), P19 (= P23), M20 (= M24), L21 (≠ A25), N69 (= N74), F71 (= F76), H133 (= H137), Q176 (≠ M180), A180 (= A184), G181 (= G185), G182 (= G186), G217 (= G221), G218 (= G222), G239 (= G243), T240 (= T244), W325 (= W328)
Q9HWH9 Nitronate monooxygenase; NMO; Propionate 3-nitronate monooxygenase; P3N monooxygenase; EC 1.13.12.- from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
43% identity, 94% coverage: 8:348/361 of query aligns to 4:345/351 of Q9HWH9
4qitA Crystal structure of nitroalkane oxidase from pseudomonas aeruginosa in mutant complex form
43% identity, 94% coverage: 8:348/361 of query aligns to 4:345/350 of 4qitA
- binding flavin mononucleotide: A18 (= A22), P19 (= P23), M20 (= M24), L21 (≠ A25), N69 (= N74), F71 (= F76), H133 (= H137), Q176 (≠ M180), A180 (= A184), G181 (= G185), G217 (= G221), G218 (= G222), M238 (≠ I242), G239 (= G243), T240 (= T244), W325 (= W328)
- binding nitroethane: F71 (= F76), G182 (= G186), S183 (≠ H187), W325 (= W328)
4qiuB Crystal structure of nitroalkane oxidase from pseudomonas aeruginosa in mutant complex form
43% identity, 94% coverage: 8:348/361 of query aligns to 3:344/350 of 4qiuB
- binding flavin mononucleotide: A17 (= A22), P18 (= P23), M19 (= M24), L20 (≠ A25), N68 (= N74), F70 (= F76), H132 (= H137), Q175 (≠ M180), A179 (= A184), G180 (= G185), G181 (= G186), G216 (= G221), G217 (= G222), G238 (= G243), T239 (= T244), W324 (= W328)
- binding 1-nitropropane: L20 (≠ A25), W324 (= W328)
6bkaA Crystal structure of nitronate monooxygenase from cyberlindnera saturnus (see paper)
32% identity, 87% coverage: 7:321/361 of query aligns to 6:340/374 of 6bkaA
- binding 3,6,9,12,15,18,21,24,27,30,33,36-dodecaoxaoctatriacontane-1,38-diol: T34 (≠ A35), R37 (≠ Q38), V67 (≠ A64), D69 (≠ C66)
- binding flavin mononucleotide: A21 (= A22), P22 (= P23), M23 (= M24), A24 (= A25), N77 (= N74), F79 (= F76), H147 (= H137), Q190 (≠ M180), A194 (= A184), G195 (= G185), G196 (= G186), G239 (= G221), G240 (= G222), G261 (= G243), T262 (= T244)
3bw2A Crystal structures and site-directed mutagenesis study of nitroalkane oxidase from streptomyces ansochromogenes (see paper)
38% identity, 93% coverage: 17:351/361 of query aligns to 9:338/347 of 3bw2A
- binding flavin mononucleotide: A14 (= A22), P15 (= P23), M16 (= M24), A17 (= A25), N66 (= N74), F68 (= F76), H124 (= H137), Q167 (≠ M180), A171 (= A184), G172 (= G185), G173 (= G186), G210 (= G221), G211 (= G222), G232 (= G243), T233 (= T244), W315 (= W328)
3bw3A Crystal structures and site-directed mutagenesis study of nitroalkane oxidase from streptomyces ansochromogenes (see paper)
38% identity, 93% coverage: 17:351/361 of query aligns to 9:338/346 of 3bw3A
- binding flavin mononucleotide: A14 (= A22), P15 (= P23), M16 (= M24), A17 (= A25), N66 (= N74), F68 (= F76), H124 (= H137), A171 (= A184), G172 (= G185), G173 (= G186), G210 (= G221), G211 (= G222), G232 (= G243), T233 (= T244), W315 (= W328)
- binding nitroethane: G18 (= G26), Y42 (≠ M49), H293 (≠ G306), R300 (= R313)
7l00C Crystal structure of c. Difficile enoyl-acyl carrier protein reductase (fabk) in complex with an inhibitor
31% identity, 82% coverage: 2:297/361 of query aligns to 5:250/315 of 7l00C
- binding flavin mononucleotide: G23 (≠ A22), G24 (≠ P23), M25 (= M24), A26 (= A25), N74 (= N74), E142 (≠ M180), G146 (≠ A184), G147 (= G185), G174 (= G221), G175 (= G222), Q194 (= Q241), G196 (= G243), T197 (= T244)
- binding N-[6-(methylsulfonyl)-1,3-benzothiazol-2-yl]-2-[2-(1H-pyrrol-1-yl)-1,3-thiazol-4-yl]acetamide: A26 (= A25), M76 (≠ F76), G100 (≠ H137), A101 (≠ F138), G102 (= G139), V121 (≠ S159), P123 (≠ T161), H149 (= H187)
Sites not aligning to the query:
5gvhA Structure of fabk from thermotoga maritima (see paper)
32% identity, 80% coverage: 8:296/361 of query aligns to 5:245/311 of 5gvhA
- binding flavin mononucleotide: G19 (≠ A22), G20 (≠ P23), M21 (= M24), A22 (= A25), N70 (= N74), I72 (≠ F76), E138 (≠ M180), S142 (≠ A184), G143 (= G185), G170 (= G221), G171 (= G222), Q190 (= Q241), G192 (= G243), T193 (= T244)
Sites not aligning to the query:
2z6iB Crystal structure of s. Pneumoniae enoyl-acyl carrier protein reductase (fabk) (see paper)
31% identity, 81% coverage: 8:301/361 of query aligns to 4:245/321 of 2z6iB
- binding calcium ion: E137 (≠ M180), H144 (= H187), A158 (= A210), I161 (≠ V213)
- binding flavin mononucleotide: G18 (≠ A22), G19 (≠ P23), M20 (= M24), A21 (= A25), N69 (= N74), E137 (≠ M180), A141 (= A184), G142 (= G185), G169 (= G221), G170 (= G222), G191 (= G243), T192 (= T244)
Sites not aligning to the query:
2z6jA Crystal structure of s. Pneumoniae enoyl-acyl carrier protein reductase (fabk) in complex with an inhibitor (see paper)
31% identity, 81% coverage: 8:301/361 of query aligns to 4:242/307 of 2z6jA
- binding calcium ion: A158 (= A210), I161 (≠ V213)
- binding flavin mononucleotide: G18 (≠ A22), G19 (≠ P23), M20 (= M24), A21 (= A25), N69 (= N74), E137 (≠ M180), A141 (= A184), G142 (= G185), G169 (= G221), G170 (= G222), G191 (= G243), T192 (= T244)
- binding 2-(4-(2-((3-(5-(pyridin-2-ylthio)thiazol-2-yl)ureido)methyl)-1h-imidazol-4-yl)phenoxy)acetic acid: N45 (≠ M49), M71 (≠ F76), L73 (≠ R115), A96 (≠ F138), G97 (= G139), V116 (≠ S159), P118 (≠ T161), L122 (≠ E165), E137 (≠ M180), H144 (= H187)
Q9I4V0 NADH:quinone reductase; EC 1.6.5.9 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
32% identity, 79% coverage: 8:292/361 of query aligns to 7:250/328 of Q9I4V0
2gjnA Crystal structure of 2-nitropropane dioxygenase complexed with fmn and substrate (see paper)
32% identity, 79% coverage: 8:292/361 of query aligns to 5:248/324 of 2gjnA
- binding flavin mononucleotide: G20 (≠ P23), M21 (= M24), Q22 (≠ A25), T73 (≠ N74), K122 (≠ S159), C147 (≠ A184), A148 (≠ G185), S176 (≠ A220), G177 (= G221), N197 (≠ Q241), M198 (≠ I242), G199 (= G243), T200 (= T244)
- binding 2-nitropropane: G149 (= G186), H150 (= H187)
Sites not aligning to the query:
6e2aA Crystal structure of nadh:quinone reductase pa1024 from pseudomonas aeruginosa pao1 in complex with NAD+ (see paper)
32% identity, 79% coverage: 8:292/361 of query aligns to 6:249/326 of 6e2aA
- binding flavin mononucleotide: G21 (≠ P23), M22 (= M24), Q23 (≠ A25), T74 (≠ N74), K123 (≠ S159), C148 (≠ A184), A149 (≠ G185), S177 (≠ A220), G178 (= G221), N198 (≠ Q241), M199 (≠ I242), G200 (= G243), T201 (= T244)
- binding nicotinamide-adenine-dinucleotide: Q23 (≠ A25), L76 (≠ F76), P77 (≠ C77), Q79 (= Q79), G150 (= G186), H151 (= H187), N236 (≠ R279)
Sites not aligning to the query:
4iqlA Crystal structure of porphyromonas gingivalis enoyl-acp reductase ii (fabk) with cofactors NADPH and fmn (see paper)
29% identity, 79% coverage: 8:292/361 of query aligns to 3:240/313 of 4iqlA
- binding flavin mononucleotide: G18 (≠ P23), M19 (= M24), V20 (≠ A25), N68 (= N74), S94 (≠ E127), E136 (≠ M180), A140 (= A184), G141 (= G185), G170 (= G221), G171 (= G222), Q190 (= Q241), G192 (= G243), T193 (= T244)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: W21 (≠ G26), W21 (≠ G26), W25 (≠ S30), S44 (≠ M49), M45 (≠ L50), M45 (≠ L50), H46 (≠ S51), N49 (≠ Q54), H52 (≠ A57), H53 (≠ E58), Y73 (≠ D84), P74 (≠ A85), E75 (= E86), S202 (≠ K253)
Sites not aligning to the query:
7e1sC Crystal structure of dehydrogenase/isomerase fabx from helicobacter pylori in complex with octanoyl-acp (see paper)
28% identity, 48% coverage: 175:349/361 of query aligns to 173:364/366 of 7e1sC
- binding S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] octanethioate: E178 (≠ M180), H185 (= H187), Y280 (≠ R279), I324 (= I315), L328 (≠ Q319)
- binding flavin mononucleotide: E178 (≠ M180), S182 (≠ A184), G183 (= G185), G223 (= G221), G224 (= G222), M244 (≠ I242), A245 (≠ G243), T246 (= T244), L249 (= L247), F342 (vs. gap), T343 (vs. gap)
- binding iron/sulfur cluster: C303 (≠ L304), N306 (≠ G307), C307 (≠ A308), V308 (≠ L309), C311 (≠ L312), G314 (vs. gap), A317 (vs. gap), C323 (≠ A314), I324 (= I315)
Sites not aligning to the query:
- binding S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] octanethioate: 104, 129, 130, 131, 150, 151, 152
- binding flavin mononucleotide: 25, 26, 27, 28, 102
- binding : 131, 133, 134, 155, 159, 162, 163, 167
7e1sA Crystal structure of dehydrogenase/isomerase fabx from helicobacter pylori in complex with octanoyl-acp (see paper)
28% identity, 48% coverage: 175:349/361 of query aligns to 173:364/366 of 7e1sA
- binding S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] octanethioate: E178 (≠ M180), H185 (= H187), G187 (= G189), Y280 (≠ R279), L328 (≠ Q319)
- binding flavin mononucleotide: E178 (≠ M180), G183 (= G185), G223 (= G221), G224 (= G222), Q243 (= Q241), M244 (≠ I242), A245 (≠ G243), T246 (= T244)
- binding iron/sulfur cluster: C303 (≠ L304), N306 (≠ G307), C307 (≠ A308), V308 (≠ L309), C311 (≠ L312), G314 (vs. gap), A317 (vs. gap), C323 (≠ A314), I324 (= I315)
Sites not aligning to the query:
- binding S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] octanethioate: 104, 129, 130, 150, 151, 152
- binding flavin mononucleotide: 25, 26, 27, 28, 102, 104
7e1rA Crystal structure of dehydrogenase/isomerase fabx from helicobacter pylori in complex with holo-acp (see paper)
28% identity, 48% coverage: 175:349/361 of query aligns to 173:364/366 of 7e1rA
- binding flavin mononucleotide: E178 (≠ M180), G183 (= G185), G224 (= G222), Q243 (= Q241), M244 (≠ I242), A245 (≠ G243), T246 (= T244), F342 (vs. gap)
- binding N~3~-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-N-(2-sulfanylethyl)-beta-alaninamide: E178 (≠ M180), H185 (= H187), G187 (= G189)
- binding iron/sulfur cluster: C303 (≠ L304), N306 (≠ G307), C307 (≠ A308), V308 (≠ L309), C311 (≠ L312), G314 (vs. gap), A317 (vs. gap), C323 (≠ A314), I324 (= I315)
Sites not aligning to the query:
7e1qA Crystal structure of dehydrogenase/isomerase fabx from helicobacter pylori (see paper)
28% identity, 48% coverage: 175:349/361 of query aligns to 173:364/366 of 7e1qA
- binding flavin mononucleotide: E178 (≠ M180), S182 (≠ A184), G183 (= G185), G223 (= G221), G224 (= G222), M244 (≠ I242), A245 (≠ G243), T246 (= T244), F342 (vs. gap)
- binding iron/sulfur cluster: P277 (≠ F276), C303 (≠ L304), N306 (≠ G307), C307 (≠ A308), V308 (≠ L309), C311 (≠ L312), G314 (vs. gap), A317 (vs. gap), C323 (≠ A314), I324 (= I315)
Sites not aligning to the query:
Query Sequence
>PP_3827 FitnessBrowser__Putida:PP_3827
MSHWPDRRILNLLGIELPILQAPMAGATGSAMAIAVGQAGGLGALPCAMLSGEQVRAEIA
AFRAGCPGRPLNLNFFCHQPPAPDAERDARWKQALEPYYSEVGADFTAPTPVSNRAPFDE
QSCLLVEALRPEVVSFHFGLPQAELLQRVKASGAKVLSSATTVEEAAWLERNGCDAIIAM
GYEAGGHRGMFLSDDITSQIGTFALVPQVADAVGVPVIAAGGIGDHRGLLAALALGASAV
QIGTAYLFCPEAKVSPAHRQALDSAPASDTALTNLFTGRPARGINNRLMRELGPMSELAP
RFPLAGGALMPLRAITDPQGKSDFSNLWSGQALRLGRHMPAGELTREIAGKALAVIGHQA
F
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory