SitesBLAST
Comparing PP_3948 FitnessBrowser__Putida:PP_3948 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3A Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
44% identity, 35% coverage: 773:1182/1187 of query aligns to 8:429/440 of 8gy3A
- binding heme c: Y52 (≠ D817), C53 (= C818), C56 (= C821), H57 (= H822), S84 (≠ T846), I86 (= I848), W97 (= W859), F102 (= F864), L117 (= L879), F121 (= F883), F126 (= F888), R163 (= R925), C203 (= C964), C206 (= C967), H207 (= H968), A232 (= A994), P233 (= P995), L235 (= L997), W245 (= W1007), Y253 (= Y1015), L254 (= L1016), G263 (= G1025), S264 (≠ V1026), M269 (= M1031), Y292 (≠ L1053), C337 (= C1088), C340 (= C1091), H341 (= H1092), P353 (= P1105), L355 (≠ M1107), N358 (= N1110), N359 (≠ S1111), V372 (= V1124), I377 (= I1129), G382 (≠ T1134), Q383 (≠ R1135), I386 (≠ G1138), M388 (= M1140), F391 (= F1143)
- binding ubiquinone-10: E55 (≠ V820), T76 (= T838), F78 (= F840), Y118 (= Y880), P119 (= P881), I160 (≠ F922), G166 (≠ M928), Q167 (≠ A929), F169 (vs. gap), W170 (= W931), H202 (= H963), R210 (= R971), L213 (≠ M974)
7w2jC Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
38% identity, 32% coverage: 806:1182/1187 of query aligns to 1:387/418 of 7w2jC
- binding heme c: C13 (= C818), C16 (= C821), H17 (= H822), T42 (= T846), I44 (= I848), Y55 (≠ W859), L75 (= L879), Y76 (= Y880), A78 (= A882), M79 (≠ F883), R122 (= R925), H161 (= H963), C162 (= C964), C165 (= C967), H166 (= H968), A191 (= A994), P192 (= P995), R223 (≠ V1026), P227 (= P1030), M228 (= M1031), V289 (≠ A1087), C290 (= C1088), C293 (= C1091), H294 (= H1092), Y305 (≠ V1103), Y306 (≠ S1104), P307 (= P1105), L309 (≠ M1107), N312 (= N1110), T313 (≠ S1111), T314 (≠ N1112), D322 (≠ N1120), I327 (≠ V1125), V331 (≠ I1129), R333 (≠ T1131), I340 (≠ G1138), M342 (= M1140), P343 (= P1141), F345 (= F1143)
8jejC Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
37% identity, 32% coverage: 806:1182/1187 of query aligns to 1:401/413 of 8jejC
- binding heme c: C13 (= C818), C16 (= C821), H17 (= H822), T42 (= T846), I44 (= I848), F60 (= F864), L64 (≠ M868), L75 (= L879), Y76 (= Y880), M79 (≠ F883), P80 (= P884), Y84 (≠ F888), R122 (= R925), C162 (= C964), C165 (= C967), H166 (= H968), I186 (≠ V989), W189 (= W992), A191 (= A994), P192 (= P995), I194 (≠ L997), W205 (= W1007), Y213 (= Y1015), R223 (≠ V1026), M228 (= M1031), V303 (≠ A1087), C304 (= C1088), C307 (= C1091), H308 (= H1092), Y320 (≠ S1104), P321 (= P1105), L323 (≠ M1107), T327 (≠ S1111), T328 (≠ N1112), D336 (≠ N1120), I341 (≠ V1125), V345 (≠ I1129), R347 (≠ T1131), I354 (≠ G1138), M356 (= M1140), F359 (= F1143), I376 (≠ L1155)
- binding ubiquinone-10: M36 (≠ F840), P77 (= P881), S124 (≠ L927), W128 (= W931), C165 (= C967), L173 (≠ G975)
Sites not aligning to the query:
Q47945 Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
36% identity, 31% coverage: 804:1168/1187 of query aligns to 42:422/478 of Q47945
Sites not aligning to the query:
- 1:36 signal peptide
- 37 modified: Pyrrolidone carboxylic acid
8gy2B Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
36% identity, 31% coverage: 804:1169/1187 of query aligns to 4:385/433 of 8gy2B
- binding heme c: C18 (= C818), C21 (= C821), H22 (= H822), T46 (= T846), I48 (= I848), Y59 (≠ W859), L68 (≠ M868), R73 (≠ S873), V79 (≠ L879), Y80 (= Y880), M83 (≠ F883), F88 (= F888), R126 (= R925), H165 (= H963), C166 (= C964), C169 (= C967), H170 (= H968), I201 (≠ E993), A202 (= A994), P203 (= P995), L205 (= L997), W216 (= W1007), F224 (≠ Y1015), A234 (≠ G1025), V235 (= V1026), F236 (≠ A1027), F236 (≠ A1027), M239 (≠ P1030), N301 (≠ A1087), C302 (= C1088), C305 (= C1091), H306 (= H1092), M316 (≠ L1100), F317 (= F1101), P318 (= P1105), L320 (≠ M1107), P324 (≠ S1111), G342 (vs. gap), S352 (≠ D1136), V354 (≠ G1138), M356 (= M1140), F359 (= F1143), M375 (≠ L1159)
- binding ubiquinone-10: C21 (= C821), L34 (= L834), P39 (= P839), P81 (= P881), L129 (≠ M928), W132 (= W931), E168 (≠ A966), R173 (= R971), I197 (≠ V989), D241 (≠ G1032)
Sites not aligning to the query:
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
27% identity, 59% coverage: 45:742/1187 of query aligns to 16:727/732 of 8gy3C
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): M38 (≠ L67), G39 (= G68), Q40 (≠ T69), H41 (≠ G70), V42 (≠ I71), A45 (≠ S74), G79 (≠ I107), G80 (≠ A108), S81 (= S109), S83 (≠ T111), V84 (≠ L112), G374 (≠ C395), F375 (≠ Y396), L379 (≠ C400), L499 (≠ M516), R500 (= R517), V624 (= V638), D625 (≠ N639), Q632 (= Q646), T687 (≠ M702), G688 (= G703), L689 (≠ S704), G690 (= G705), E691 (= E706)
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
25% identity, 28% coverage: 267:601/1187 of query aligns to 110:439/748 of 5y6qC
Sites not aligning to the query:
- active site: 715, 716
- binding pterin cytosine dinucleotide: 461, 462, 463, 464, 468, 500, 502, 503, 504, 505, 638, 640, 641, 648, 711, 713, 714, 715
5g5gC Escherichia coli periplasmic aldehyde oxidase (see paper)
26% identity, 34% coverage: 184:591/1187 of query aligns to 12:436/731 of 5g5gC
Sites not aligning to the query:
- active site: 692, 693
- binding pterin cytosine dinucleotide: 468, 469, 470, 507, 509, 511, 512, 617, 618, 621, 625, 688, 690, 691, 692
P77489 Aldehyde oxidoreductase molybdenum-binding subunit PaoC; EC 1.2.99.6 from Escherichia coli (strain K12) (see 2 papers)
26% identity, 34% coverage: 184:591/1187 of query aligns to 12:436/732 of P77489
Sites not aligning to the query:
- 440 mutation R->H,K: Decrease in catalytic efficiency.
- 468:470 binding
- 511:512 binding
- 615:621 binding
- 625 binding
- 688:691 binding
- 692 E→Q: Loss of activity.
3hrdE Crystal structure of nicotinate dehydrogenase (see paper)
22% identity, 31% coverage: 185:548/1187 of query aligns to 2:381/420 of 3hrdE
- active site: Q207 (= Q365), L242 (≠ C400), R318 (≠ M486), H322 (≠ T490), R350 (= R517)
- binding calcium ion: T206 (= T364), N208 (= N366), D212 (≠ L370), K241 (≠ N399), L242 (≠ C400), D243 (≠ A401)
- binding pterin cytosine dinucleotide: G237 (≠ C395), F238 (≠ Y396), R350 (= R517)
- binding selenium atom: F238 (≠ Y396), A348 (≠ W515), F349 (≠ M516), R350 (= R517)
3hrdA Crystal structure of nicotinate dehydrogenase (see paper)
22% identity, 31% coverage: 185:548/1187 of query aligns to 2:381/420 of 3hrdA
- active site: Q207 (= Q365), L242 (≠ C400), R318 (≠ M486), H322 (≠ T490), R350 (= R517)
- binding pterin cytosine dinucleotide: G236 (= G394), G237 (≠ C395), F238 (≠ Y396), R350 (= R517)
- binding magnesium ion: T206 (= T364), N208 (= N366), D212 (≠ L370), K241 (≠ N399), L242 (≠ C400), D243 (≠ A401), T305 (vs. gap), Y308 (= Y461), A309 (≠ P462), S346 (≠ A513)
- binding nicotinic acid: A314 (= A482), R318 (≠ M486), F352 (≠ V519)
- binding selenium atom: F238 (≠ Y396), G239 (= G397), A348 (≠ W515), F349 (≠ M516), R350 (= R517)
Q0QLF2 Nicotinate dehydrogenase large molybdopterin subunit; NDH; Nicotinic acid hydroxylase large molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see 2 papers)
22% identity, 31% coverage: 185:548/1187 of query aligns to 3:382/425 of Q0QLF2
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2:425 modified: mature protein, Nicotinate dehydrogenase large molybdopterin subunit
1rm6A Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
26% identity, 30% coverage: 190:547/1187 of query aligns to 3:380/761 of 1rm6A
Sites not aligning to the query:
- active site: 718, 719
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 473, 474, 475, 476, 513, 514, 515, 517, 518, 646, 647, 651, 654, 714, 715, 716, 717, 718
O33819 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.1.7.1 from Thauera aromatica (see paper)
25% identity, 30% coverage: 190:547/1187 of query aligns to 11:388/769 of O33819
Sites not aligning to the query:
- 522:526 binding
- 650:655 binding
- 722:725 binding
3hrdB Crystal structure of nicotinate dehydrogenase (see paper)
36% identity, 10% coverage: 47:166/1187 of query aligns to 25:146/330 of 3hrdB
Sites not aligning to the query:
- active site: 289, 290
- binding pterin cytosine dinucleotide: 215, 216, 219, 220, 223, 285, 286, 287, 288, 289
- binding nicotinic acid: 17, 18
Q0QLF1 Nicotinate dehydrogenase medium molybdopterin subunit; NDH; Nicotinic acid hydroxylase medium molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
36% identity, 10% coverage: 47:166/1187 of query aligns to 25:146/330 of Q0QLF1
Sites not aligning to the query:
- 211:223 binding
- 284:289 binding
4yswA Structure of rat xanthine oxidoreductase, c-terminal deletion protein variant, nadh bound form (see paper)
24% identity, 31% coverage: 189:551/1187 of query aligns to 543:917/1286 of 4yswA
- active site: Q738 (= Q365), E773 (≠ N399), R851 (≠ E478), H855 (≠ E485), R883 (= R517)
- binding bicarbonate ion: R810 (≠ G435), H811 (≠ T436), I848 (≠ G475), T880 (≠ S514), A881 (≠ W515), F882 (≠ M516), F885 (≠ V519), G886 (≠ S520), Q889 (≠ P523)
- binding calcium ion: G838 (= G465), T841 (= T468), E842 (≠ L469), S845 (≠ L472), S878 (≠ R512), N879 (≠ A513)
- binding fe2/s2 (inorganic) cluster: L715 (≠ I344)
- binding uric acid: E773 (≠ N399), R851 (≠ E478), F885 (≠ V519)
Sites not aligning to the query:
- active site: 1231, 1232
- binding flavin-adenine dinucleotide: 44, 226, 227, 228, 229, 230, 231, 232, 233, 234, 307, 308, 312, 316, 317, 320, 321, 323, 324, 329, 330, 373, 374, 399
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 113, 145, 147
- binding 1,4-dihydronicotinamide adenine dinucleotide: 233, 326, 327, 328, 363, 364, 400, 401, 428, 430, 431, 471, 478, 1196
- binding uric acid: 980, 981, 1050, 1232
6a7xB Rat xanthine oxidoreductase, d428a variant, NAD bound form
24% identity, 31% coverage: 189:551/1187 of query aligns to 543:917/1291 of 6a7xB
- active site: Q738 (= Q365), E773 (≠ N399), R851 (≠ E478), H855 (≠ E485), R883 (= R517)
- binding bicarbonate ion: R810 (≠ G435), H811 (≠ T436), T880 (≠ S514), A881 (≠ W515), F885 (≠ V519), G886 (≠ S520), Q889 (≠ P523)
- binding fe2/s2 (inorganic) cluster: L715 (≠ I344)
- binding uric acid: E773 (≠ N399), R851 (≠ E478), F885 (≠ V519)
Sites not aligning to the query:
- active site: 1231, 1232
- binding flavin-adenine dinucleotide: 44, 227, 228, 229, 230, 231, 232, 233, 234, 307, 312, 317, 320, 321, 323, 324, 330, 373, 374
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147
- binding nicotinamide-adenine-dinucleotide: 327, 363, 364, 428, 430, 431, 471, 478
- binding uric acid: 980, 981, 1049, 1050, 1232
2e3tA Crystal structure of rat xanthine oxidoreductase mutant (w335a and f336l) (see paper)
24% identity, 31% coverage: 189:551/1187 of query aligns to 545:919/1291 of 2e3tA
- active site: Q740 (= Q365), E775 (≠ N399), R853 (≠ E478), H857 (≠ E485), R885 (= R517)
- binding bicarbonate ion: R812 (≠ G435), H813 (≠ T436), I850 (≠ G475), T882 (≠ S514), A883 (≠ W515), F887 (≠ V519), G888 (≠ S520), Q891 (≠ P523)
- binding calcium ion: E713 (≠ L340), H714 (= H341), Y716 (≠ S343), T809 (≠ E432), G810 (≠ P433), G840 (= G465), T843 (= T468), E844 (≠ L469), S847 (≠ L472), S880 (≠ R512), N881 (≠ A513)
- binding fe2/s2 (inorganic) cluster: L717 (≠ I344)
- binding uric acid: E775 (≠ N399), R853 (≠ E478), F887 (≠ V519)
Sites not aligning to the query:
- active site: 1233, 1234
- binding flavin-adenine dinucleotide: 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 113, 145, 147
- binding uric acid: 982, 983, 1051, 1052, 1234
6a7xA Rat xanthine oxidoreductase, d428a variant, NAD bound form
24% identity, 31% coverage: 189:551/1187 of query aligns to 545:919/1295 of 6a7xA
- active site: Q740 (= Q365), E775 (≠ N399), R853 (≠ E478), H857 (≠ E485), R885 (= R517)
- binding bicarbonate ion: R812 (≠ G435), H813 (≠ T436), I850 (≠ G475), A883 (≠ W515), F884 (≠ M516), F887 (≠ V519), G888 (≠ S520), Q891 (≠ P523)
- binding uric acid: E775 (≠ N399), R853 (≠ E478), F887 (≠ V519)
Sites not aligning to the query:
- active site: 1233, 1234
- binding flavin-adenine dinucleotide: 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 314, 319, 322, 323, 325, 326, 332, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147
- binding nicotinamide-adenine-dinucleotide: 329, 365, 366, 432, 433, 473, 480
- binding uric acid: 982, 983, 1052, 1234
Query Sequence
>PP_3948 FitnessBrowser__Putida:PP_3948
MNHSQQVPSRDQLLAKTGVLLIVDQITPPSGPVAKGVTPTVKERELALFIAVSDDGMVYA
FNGHVDLGTGIRTSLAQIVAEELDLRMDQVHMVLGDTERAPNQGATIASATLQISAVPLR
KAAATARRYLLQQAALRLGCPPEMLRIEDGTVIASNGSTLSFAELVQGKNHQLHIADDAP
LKAIEDYRLVGRSAPRVDIPGKATGELTYVHDMRLPNMLHGRVIRPPYAGHDSGDFVGNS
LLAVDESSIAHLPGVVAVVVIRDFVGVVAEREEQAIRAAHELKVSWKPFTGKLPDLSDVA
QAIRDNPRVQRTVLDQGDVDGGIANASQRLSRSYLWPYQLHASIGPSCALADFTAGQIRV
WSGTQNPHLLRADLAWLLACDEARIEIIRMEAAGCYGRNCADDVCADAVLLSRAVQRPVR
VQLTREQEHVWEPKGTAQLMEIDGGLNADGSVAAYDFQTSYPSNGAPTLALLLTGAVEPV
PALFEMGDRTSIPPYDYEHMRVTINDMTPLVRASWMRGVSAMPNSFAHESYIDELAFAAG
VDPVEYRLKHLSDPRAIDLVKATAERAQWQPHTRPMQTQAEGDVLRGRGFAYARYIHSKF
PGFGAAWAAWVADVAVDRRTGEVAVTRVVIGHDAGMMVNPEGVRHQIHGNVIQSTSRVLK
EQVSFEESTVASKEWGGYPILTFPELPAIDVMMLPRQHEPPMGSGESASVPSAAAIANAI
FDATGIRFRELPITAERVRAALGGEGQGPDAPAPAQPSTKRSKWWFGSLAGVFGAALGML
ATALPWRAEIAPVTPPGVGSWSAAMLERGRQVAAAGDCAVCHTVSGGKANAGGLAMDTPF
GTLYSTNITPDPETGIGRWSFAAFERAMREGISRDGRHLYPAFPYTSFRNINDADMQALY
AYLMSQTPVRQEAPANQMRFPFNQRPLMAGWNARFLQRGEYQPDPQRSAQWNRGAYLVDG
LGHCTACHSPRNLMGAEKGGSSYLAGGMVDGWEAPALNALGKSSTPWSEDELFNYLSTGF
SEKHGVAAGPMGPVVSELATLPKSDVRAIAHYLSSLEGEPQALAANAAPQVDTHVSLSNG
ERVFKGACLGCHSDGLGPKLFGVSPSMAVNSNVHSDLPDNLLRVVLHGIPTPATRDLGYM
PGFKDSLSDRQVADLAAYLRHRFAADKPAWQGLASKAAQVRANPGSH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory