Comparing PP_3951 FitnessBrowser__Putida:PP_3951 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
3k6mC Dynamic domains of succinyl-coa:3-ketoacid-coenzyme a transferase from pig heart. (see paper)
42% identity, 93% coverage: 4:217/231 of query aligns to 2:231/466 of 3k6mC
Sites not aligning to the query:
Q29551 Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial; SCOT; 3-oxoacid CoA-transferase 1; Somatic-type succinyl-CoA:3-oxoacid CoA-transferase; SCOT-s; Succinate-coenzyme A transferase; Succinyl-CoA:3-oxoacid CoA transferase; EC 2.8.3.5 from Sus scrofa (Pig) (see 3 papers)
42% identity, 93% coverage: 4:217/231 of query aligns to 41:270/520 of Q29551
Sites not aligning to the query:
1o9lA Succinate:coenzyme-a transferase (pig heart)
42% identity, 93% coverage: 4:217/231 of query aligns to 2:231/468 of 1o9lA
3oxoE Succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa (see paper)
42% identity, 93% coverage: 4:217/231 of query aligns to 2:231/462 of 3oxoE
Sites not aligning to the query:
1k6dB Crystal structure of acetate coa-transferase alpha subunit (see paper)
45% identity, 87% coverage: 18:217/231 of query aligns to 17:214/219 of 1k6dB
6lp1C Crystal structure of acetate:succinate coa transferase (asct) from trypanosoma brucei. (see paper)
41% identity, 91% coverage: 8:217/231 of query aligns to 8:233/469 of 6lp1C
Q0S7P9 Cholesterol ring-cleaving hydrolase IpdA subunit; (3E)-2-(2-carboxylatoethyl)-3-methyl-6-oxocyclohex-1-ene-1-carboxyl-CoA hydrolase alpha subunit; COCHEA-CoA hydrolase alpha subunit; EC 4.1.99.- from Rhodococcus jostii (strain RHA1) (see paper)
28% identity, 84% coverage: 8:201/231 of query aligns to 10:214/296 of Q0S7P9
6co9A Crystal structure of rhodococcus jostii rha1 ipdab cochea-coa complex (see paper)
28% identity, 84% coverage: 8:201/231 of query aligns to 9:213/295 of 6co9A
2ahvA Crystal structure of acyl-coa transferase from e. Coli o157:h7 (ydif)- thioester complex with coa- 1 (see paper)
29% identity, 91% coverage: 8:217/231 of query aligns to 14:248/512 of 2ahvA
Sites not aligning to the query:
>PP_3951 FitnessBrowser__Putida:PP_3951
MINKTYESIASAVEGITDGSTIMVGGFGTAGMPSELIDGLIATGARDLTIISNNAGNGEI
GLAALLMAGSVRKVVCSFPRQSDSYVFDELYRAGKIELEVVPQGNLAERIRAAGSGIGAF
FSPTGYGTLLAEGKETREIDGRMYVLEMPLHADFALIKAHKGDRWGNLTYRKAARNFGPI
MAMAAKTAIAQVDQVVELGELDPEHIITPGIFVQRVVAVTGAAASSIAKAV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory