Comparing PP_4012 FitnessBrowser__Putida:PP_4012 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
1j1wA Crystal structure of the monomeric isocitrate dehydrogenase in complex with NADP+ (see paper)
79% identity, 99% coverage: 6:741/741 of query aligns to 3:738/738 of 1j1wA
1itwA Crystal structure of the monomeric isocitrate dehydrogenase in complex with isocitrate and mn (see paper)
79% identity, 99% coverage: 6:741/741 of query aligns to 4:739/740 of 1itwA
P16100 Isocitrate dehydrogenase [NADP]; IDH; Oxalosuccinate decarboxylase; EC 1.1.1.42 from Azotobacter vinelandii (see 2 papers)
78% identity, 99% coverage: 6:741/741 of query aligns to 5:740/741 of P16100
Sites not aligning to the query:
6g3uA Structure of pseudomonas aeruginosa isocitrate dehydrogenase, idh (see paper)
66% identity, 99% coverage: 5:741/741 of query aligns to 1:736/737 of 6g3uA
5z16B A novel dimeric isocitrate dehydrogenase from acinetobacter baumannii
63% identity, 99% coverage: 5:741/741 of query aligns to 1:738/739 of 5z16B
P50216 Isocitrate dehydrogenase [NADP]; IDH; Oxalosuccinate decarboxylase; EC 1.1.1.42 from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
63% identity, 99% coverage: 5:741/741 of query aligns to 2:736/738 of P50216
3mbcA Crystal structure of monomeric isocitrate dehydrogenase from corynebacterium glutamicum in complex with NADP (see paper)
63% identity, 99% coverage: 5:741/741 of query aligns to 1:735/735 of 3mbcA
2b0tA Structure of monomeric NADP isocitrate dehydrogenase (see paper)
63% identity, 99% coverage: 5:741/741 of query aligns to 1:735/735 of 2b0tA
4zdaA Crystal structure of isocitrate dehydrogenase in complex with isocitrate and mn from m. Smegmatis
62% identity, 99% coverage: 7:738/741 of query aligns to 3:735/735 of 4zdaA
5kvuA Crystal structure of isocitrate dehydrogenase-2 in complex with NADP(+) from mycobacterium tuberculosis
61% identity, 99% coverage: 7:741/741 of query aligns to 4:738/738 of 5kvuA
7y1uA Crystal structure of isocitrate dehydrogenase from campylobacter corcagiensis
56% identity, 99% coverage: 7:738/741 of query aligns to 2:722/723 of 7y1uA
>PP_4012 FitnessBrowser__Putida:PP_4012
MPTRSKIIYTFTDEAPALATYSLLPIIEAFTASADIAVETRDISLAGRILAAFPEQLGAE
KQVGDHLAELGQLATTPEANIIKLPNISASVPQLKAAIKELQGKGFNIPDYADEPATAEE
KESRARYDRIKGSAVNPVLREGNSDRRAPLSVKNYARKHPHKMGAWAADSKSHVAHMTQG
DFYGSEKAALIEADDSLRIELVGKDGSTTVLKEKTAVKAAEVIDCATMSRKALKAFIAEQ
IADAKAAGVLLSVHLKATMMKVSDPIMFGVIVEEFYNDVLTKHAAALAEVGFNANNGIGD
LYARIKDLPADKQAEIEADIQALYAERPALAMVNSDKGITNLHVPSDVIVDASMPAMIRD
SGKMWNAAGELQDAKAVIPDRCYAGIYQATIEDCKVNGAFDPTTMGSVPNVGLMAQKAEE
YGSHDKTFQIKADGVVRVVDGKGNVVLEQNVEAGDIFRMCQTKDAPIQDWVKLAVNRARL
SNTPAVFWLDPARAHDGVMIEKVQKYLKDHDTTGLDIRILAPVDAIKFSLARIREGKDTI
SVTGNVLRDYLTDLFPIMELGTSAKMLSIVPLMNGGGLFETGAGGSAPKHVQQLVEENFL
RWDSLGEFLALAASLEHLGNTYDNPRAKVLANTLDQATGKFLDTNKSPSRKVGGIDNRGS
HFYLTLYWAEALAAQTDDAALQARFAPLAKTLAENEATIVAELNAVQGKPADIGGYYAPD
AELTAKVMRPSQTLNSAIAAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory