SitesBLAST
Comparing PP_4154 FitnessBrowser__Putida:PP_4154 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6torB Human o-phosphoethanolamine phospho-lyase (see paper)
41% identity, 41% coverage: 575:972/976 of query aligns to 3:394/404 of 6torB
5g4jA Phospholyase a1rdf1 from arthrobacter in complex with phosphoethanolamine (see paper)
32% identity, 43% coverage: 553:969/976 of query aligns to 2:415/423 of 5g4jA
- active site: S14 (≠ Q565), Y130 (= Y681), D201 (≠ E755), D234 (= D788), Q237 (= Q791), K264 (= K818), T294 (≠ S848), K395 (= K949)
- binding {5-hydroxy-6-methyl-4-[(E)-{[2-(phosphonooxy)ethyl]imino}methyl]pyridin-3-yl}methyl dihydrogen phosphate: Y44 (≠ L595), R73 (= R624), G103 (= G654), S104 (≠ T655), Y130 (= Y681), H131 (= H682), D234 (= D788), V236 (= V790), Q237 (= Q791), K264 (= K818), T294 (≠ S848), R397 (≠ K951)
5g4iA Plp-dependent phospholyase a1rdf1 from arthrobacter aurescens tc1 (see paper)
32% identity, 43% coverage: 553:969/976 of query aligns to 2:415/423 of 5g4iA
- active site: S14 (≠ Q565), Y130 (= Y681), D201 (≠ E755), D234 (= D788), Q237 (= Q791), K264 (= K818), T294 (≠ S848), K395 (= K949)
- binding pyridoxal-5'-phosphate: G103 (= G654), S104 (≠ T655), H131 (= H682), D234 (= D788), V236 (= V790), Q237 (= Q791), K264 (= K818)
- binding phosphate ion: Y44 (≠ L595), R397 (≠ K951)
1zobA Crystal structure of dialkylglycine decarboxylases bound with calcium ion
31% identity, 41% coverage: 558:962/976 of query aligns to 4:417/431 of 1zobA
- active site: G19 (vs. gap), W136 (≠ Y681), E208 (= E755), D241 (= D788), Q244 (= Q791), K270 (= K818), T301 (≠ S848), R404 (≠ K949)
- binding calcium ion: L76 (≠ T621), S78 (= S623), V303 (≠ G850), S304 (≠ G851), D305 (≠ S852)
- binding pyridoxal-5'-phosphate: T108 (≠ S653), A110 (≠ T655), N113 (= N658), W136 (≠ Y681), H137 (= H682), E208 (= E755), D241 (= D788), A243 (≠ V790), Q244 (= Q791), K270 (= K818)
1zc9A The crystal structure of dialkylglycine decarboxylase complex with pyridoxamine 5-phosphate (see paper)
31% identity, 41% coverage: 558:962/976 of query aligns to 4:417/431 of 1zc9A
- active site: G19 (vs. gap), W136 (≠ Y681), E208 (= E755), D241 (= D788), Q244 (= Q791), K270 (= K818), T301 (≠ S848), R404 (≠ K949)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G109 (= G654), A110 (≠ T655), W136 (≠ Y681), H137 (= H682), E208 (= E755), D241 (= D788), A243 (≠ V790), Q244 (= Q791), K270 (= K818)
1m0qA Structure of dialkylglycine decarboxylase complexed with s-1- aminoethanephosphonate (see paper)
31% identity, 41% coverage: 558:962/976 of query aligns to 4:417/431 of 1m0qA
- active site: G19 (vs. gap), W136 (≠ Y681), E208 (= E755), D241 (= D788), Q244 (= Q791), K270 (= K818), T301 (≠ S848), R404 (≠ K949)
- binding (1s)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]ethylphosphonic acid: Q50 (vs. gap), T108 (≠ S653), A110 (≠ T655), W136 (≠ Y681), H137 (= H682), E208 (= E755), S213 (≠ N760), D241 (= D788), A243 (≠ V790), Q244 (= Q791), K270 (= K818), R404 (≠ K949)
1m0pA Structure of dialkylglycine decarboxylase complexed with 1-amino-1- phenylethanephosphonate (see paper)
31% identity, 41% coverage: 558:962/976 of query aligns to 4:417/431 of 1m0pA
- active site: G19 (vs. gap), W136 (≠ Y681), E208 (= E755), D241 (= D788), Q244 (= Q791), K270 (= K818), T301 (≠ S848), R404 (≠ K949)
- binding (1r)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]-1-phenylethylphosphonic acid: Q50 (vs. gap), T108 (≠ S653), A110 (≠ T655), W136 (≠ Y681), H137 (= H682), E208 (= E755), S213 (≠ N760), D241 (= D788), A243 (≠ V790), Q244 (= Q791), K270 (= K818), R404 (≠ K949)
1m0oA Structure of dialkylglycine decarboxylase complexed with 1-amino-1- methylpropanephosphonate (see paper)
31% identity, 41% coverage: 558:962/976 of query aligns to 4:417/431 of 1m0oA
- active site: G19 (vs. gap), W136 (≠ Y681), E208 (= E755), D241 (= D788), Q244 (= Q791), K270 (= K818), T301 (≠ S848), R404 (≠ K949)
- binding (1r)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]-1-methylpropylphosphonic acid: Q50 (vs. gap), G109 (= G654), A110 (≠ T655), W136 (≠ Y681), H137 (= H682), E208 (= E755), D241 (= D788), Q244 (= Q791), K270 (= K818), R404 (≠ K949)
1m0nA Structure of dialkylglycine decarboxylase complexed with 1- aminocyclopentanephosphonate (see paper)
31% identity, 41% coverage: 558:962/976 of query aligns to 4:417/431 of 1m0nA
- active site: G19 (vs. gap), W136 (≠ Y681), E208 (= E755), D241 (= D788), Q244 (= Q791), K270 (= K818), T301 (≠ S848), R404 (≠ K949)
- binding 1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]cyclopentylphosphonic acid: Q50 (vs. gap), M51 (vs. gap), A110 (≠ T655), N113 (= N658), W136 (≠ Y681), H137 (= H682), E208 (= E755), S213 (≠ N760), D241 (= D788), A243 (≠ V790), Q244 (= Q791), K270 (= K818), R404 (≠ K949)
1dgdA An alkali metal ion size-dependent switch in the active site structure of dialkylglycine decarboxylase (see paper)
31% identity, 41% coverage: 558:962/976 of query aligns to 4:417/431 of 1dgdA
- active site: G19 (vs. gap), W136 (≠ Y681), E208 (= E755), D241 (= D788), Q244 (= Q791), K270 (= K818), T301 (≠ S848), R404 (≠ K949)
- binding pyridoxal-5'-phosphate: T108 (≠ S653), G109 (= G654), A110 (≠ T655), W136 (≠ Y681), H137 (= H682), E208 (= E755), D241 (= D788), A243 (≠ V790), Q244 (= Q791), K270 (= K818)
1d7vA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with nma (see paper)
31% identity, 41% coverage: 558:962/976 of query aligns to 4:417/431 of 1d7vA
- active site: G19 (vs. gap), W136 (≠ Y681), E208 (= E755), D241 (= D788), Q244 (= Q791), K270 (= K818), T301 (≠ S848), R404 (≠ K949)
- binding potassium ion: H75 (vs. gap), L76 (≠ T621), F77 (≠ N622), S78 (= S623), T301 (≠ S848), H302 (≠ A849), V303 (≠ G850), S304 (≠ G851), D305 (≠ S852)
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-2-methylalanine: A110 (≠ T655), W136 (≠ Y681), H137 (= H682), E208 (= E755), S213 (≠ N760), D241 (= D788), A243 (≠ V790), Q244 (= Q791), K270 (= K818), R404 (≠ K949)
1d7uA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with lcs (see paper)
31% identity, 41% coverage: 558:962/976 of query aligns to 4:417/431 of 1d7uA
- active site: G19 (vs. gap), W136 (≠ Y681), E208 (= E755), D241 (= D788), Q244 (= Q791), K270 (= K818), T301 (≠ S848), R404 (≠ K949)
- binding potassium ion: H75 (vs. gap), L76 (≠ T621), F77 (≠ N622), S78 (= S623), T301 (≠ S848), H302 (≠ A849), V303 (≠ G850), S304 (≠ G851), D305 (≠ S852)
- binding [5-hydroxy-6-methyl-4-({[(4E)-3-oxo-1,2-oxazolidin-4-ylidene]amino}methyl)pyridin-3-yl]methyl dihydrogen phosphate: G109 (= G654), A110 (≠ T655), W136 (≠ Y681), H137 (= H682), E208 (= E755), D241 (= D788), A243 (≠ V790), Q244 (= Q791), K270 (= K818), R404 (≠ K949)
1d7sA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with dcs (see paper)
31% identity, 41% coverage: 558:962/976 of query aligns to 4:417/431 of 1d7sA
- active site: G19 (vs. gap), W136 (≠ Y681), E208 (= E755), D241 (= D788), Q244 (= Q791), K270 (= K818), T301 (≠ S848), R404 (≠ K949)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: Q50 (vs. gap), G109 (= G654), A110 (≠ T655), W136 (≠ Y681), H137 (= H682), E208 (= E755), D241 (= D788), A243 (≠ V790), Q244 (= Q791), K270 (= K818), R404 (≠ K949)
- binding potassium ion: H75 (vs. gap), L76 (≠ T621), F77 (≠ N622), S78 (= S623), T301 (≠ S848), H302 (≠ A849), V303 (≠ G850), S304 (≠ G851), D305 (≠ S852)
1d7rA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with 5pa (see paper)
31% identity, 41% coverage: 558:962/976 of query aligns to 4:417/431 of 1d7rA
- active site: G19 (vs. gap), W136 (≠ Y681), E208 (= E755), D241 (= D788), Q244 (= Q791), K270 (= K818), T301 (≠ S848), R404 (≠ K949)
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-y-lmethyl]-1-amino-cyclopropanecarboxylic acid: G109 (= G654), A110 (≠ T655), W136 (≠ Y681), H137 (= H682), E208 (= E755), S213 (≠ N760), D241 (= D788), A243 (≠ V790), Q244 (= Q791), K270 (= K818), R404 (≠ K949)
- binding potassium ion: H75 (vs. gap), L76 (≠ T621), F77 (≠ N622), S78 (= S623), T301 (≠ S848), H302 (≠ A849), V303 (≠ G850), S304 (≠ G851), D305 (≠ S852)
5wyaA Structure of amino acid racemase, 2.65 a (see paper)
29% identity, 43% coverage: 553:969/976 of query aligns to 8:426/439 of 5wyaA
- active site: A20 (≠ Q565), Y140 (= Y681), E215 (= E755), D248 (= D788), N251 (≠ Q791), K278 (= K818), T307 (≠ S847), R406 (≠ K949)
- binding (2S,3S)-3-methyl-2-[[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylamino]pentanoic acid: A52 (≠ V598), Y82 (≠ R624), S112 (= S653), G113 (= G654), S114 (≠ T655), Y140 (= Y681), H141 (= H682), E215 (= E755), D248 (= D788), V250 (= V790), N251 (≠ Q791), K278 (= K818), F306 (= F846), T307 (≠ S847), R406 (≠ K949)
5wyfA Structure of amino acid racemase, 2.12 a (see paper)
28% identity, 43% coverage: 547:969/976 of query aligns to 4:428/446 of 5wyfA
- active site: A22 (≠ Q565), Y142 (= Y681), E217 (= E755), D250 (= D788), N253 (≠ Q791), K280 (= K818), T309 (≠ S847), R408 (≠ K949)
- binding n-[o-phosphono-pyridoxyl]-isoleucine: A54 (≠ V598), Y84 (≠ R624), G115 (= G654), S116 (≠ T655), Y142 (= Y681), H143 (= H682), D222 (≠ N760), D250 (= D788), V252 (= V790), N253 (≠ Q791), K280 (= K818), F308 (= F846), T309 (≠ S847), R408 (≠ K949)
4ysnC Structure of aminoacid racemase in complex with plp (see paper)
28% identity, 43% coverage: 547:969/976 of query aligns to 11:435/448 of 4ysnC
- active site: A29 (≠ Q565), Y149 (= Y681), E224 (= E755), D257 (= D788), N260 (≠ Q791), K287 (= K818), T316 (≠ S847), R415 (≠ K949)
- binding pyridoxal-5'-phosphate: S121 (= S653), G122 (= G654), S123 (≠ T655), Y149 (= Y681), H150 (= H682), E224 (= E755), D257 (= D788), V259 (= V790), K287 (= K818), F315 (= F846), T316 (≠ S847)
1szkA The structure of gamma-aminobutyrate aminotransferase mutant: e211s (see paper)
29% identity, 43% coverage: 551:974/976 of query aligns to 4:422/425 of 1szkA
- active site: V18 (≠ Q565), Y137 (= Y681), E205 (= E755), D238 (= D788), Q241 (= Q791), K267 (= K818), T296 (≠ S848), R397 (≠ K949)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G110 (= G654), S111 (≠ T655), Y137 (= Y681), H138 (= H682), E205 (= E755), D238 (= D788), V240 (= V790), Q241 (= Q791), K267 (= K818)
1sffA Structure of gamma-aminobutyrate aminotransferase complex with aminooxyacetate (see paper)
29% identity, 43% coverage: 551:974/976 of query aligns to 4:422/425 of 1sffA
- active site: V18 (≠ Q565), Y137 (= Y681), E205 (= E755), D238 (= D788), Q241 (= Q791), K267 (= K818), T296 (≠ S848), R397 (≠ K949)
- binding 4'-deoxy-4'-acetylyamino-pyridoxal-5'-phosphate: Q78 (vs. gap), G110 (= G654), S111 (≠ T655), Y137 (= Y681), H138 (= H682), R140 (≠ W684), E205 (= E755), D238 (= D788), V240 (= V790), Q241 (= Q791), K267 (= K818), T296 (≠ S848)
- binding sulfate ion: N152 (≠ A696), Y393 (≠ L945)
1sf2A Structure of e. Coli gamma-aminobutyrate aminotransferase (see paper)
29% identity, 43% coverage: 551:974/976 of query aligns to 4:422/425 of 1sf2A
- active site: V18 (≠ Q565), Y137 (= Y681), E205 (= E755), D238 (= D788), Q241 (= Q791), K267 (= K818), T296 (≠ S848), R397 (≠ K949)
- binding pyridoxal-5'-phosphate: G110 (= G654), S111 (≠ T655), Y137 (= Y681), H138 (= H682), E205 (= E755), D238 (= D788), V240 (= V790), Q241 (= Q791), K267 (= K818)
- binding sulfate ion: N152 (≠ A696), Y393 (≠ L945)
Query Sequence
>PP_4154 FitnessBrowser__Putida:PP_4154
MSSPQHQPASPALATLIQRSGQPSPTLSEAQAHAVLQAHYGLAGNLSVLGSQQDLNFRVV
TPQGGYVLKACHGSYAQLELEAQHAALAFLRDQGLPVPAVRSAHNGMGLLELDIDAQPLR
LRLLDYIEGQPLTRLKHMEPRLMAELGGLCAKLDKALAHFDHPGLARTLQWDPQHAGALI
DHLLPVLQDGGQRARIEHATRQANEHLMPLVDQLPSQAVHLDITDDNTVWARDAQRQWQL
QGVIDFGDLLRTWRIADLSVTCAALLHHAEGDPLRILPAVQAYQALNPLTEAELRALWPL
VLNRAAVLVLSSEQQLTVDPGNQYTRDNIAHEWEIFDTATAVPFALMEAAILQAAGLQPA
APDWNDCAPLLPELAGLAVTRVDLGVLSKHFEAGNWEQPGYDQHLLTSQAAPACSLHGQY
RLSQTHIDRPEEPATCALFVELHVPNGSPVQAPAAGTWQHSGDGRGCLRTPHWALWLQGL
EDAPADGQAVEKGQALGSSCGFLSVQVCLDNGSQPPRFATPSQAAAWLALCPSPAALLGF
DCDAEPLPDPQALLARRDASFARSQKHYYAQPPHIERGWRNYLIDMQGRSYLDMLNNVAV
LGHGHPRMVAESARQWSLLNTNSRFHYAAITEFSERLLDLAPEGFDRVFMVNSGTEANDL
AIRLAWAYSGGRDLLSVLEAYHGWSVATDAISTSIADNPQALETRPDWVHPVEAPNTFRG
RFRGADSAADYLQDVDAKLADLDARGRQLAGIICEPVYGNAGGISLPAGYLRAAYAKVRA
RGGVCIADEVQVGYGRLGEYFWGFEEQGVVPDIITMAKGMGNGQPLGVVITRREIAEALE
AEGYFFSSAGGSPVSCRIGMAVLDVMQEEGLWDNARDTGRYFKARLQALVDKHPLAGAAH
GSGFYLGLELVRDRTTLEPATEETMMLCDRLRDLGIFMQPTGDYLNILKIKPPMCTSRAS
VDYFVDSIDRVLGEGL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory