Comparing PP_4194 FitnessBrowser__Putida:PP_4194 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0ABH7 Citrate synthase; EC 2.3.3.16 from Escherichia coli (strain K12) (see 2 papers)
72% identity, 98% coverage: 1:422/429 of query aligns to 1:421/427 of P0ABH7
4jagA Structural determination of the a50t:s279g:s280k:v281k:k282e:h283n variant of citrate synthase from e. Coli complexed with oxaloacetate (see paper)
72% identity, 98% coverage: 2:422/429 of query aligns to 1:420/426 of 4jagA
4jaeA Structural determination of the a50t:s279g:s280k:v281k:k282e:h283n variant of citrate synthase from e. Coli complexed with s- carboxymethyl-coa (see paper)
72% identity, 98% coverage: 2:422/429 of query aligns to 1:420/426 of 4jaeA
1owbA Three dimensional structure analysis of the variant r109l nadh complex of type ii citrate synthase from e. Coli (see paper)
72% identity, 98% coverage: 2:422/429 of query aligns to 1:420/426 of 1owbA
1nxgA The f383a variant of type ii citrate synthase complexed with nadh (see paper)
72% identity, 98% coverage: 2:422/429 of query aligns to 1:420/426 of 1nxgA
2h12B Structure of acetobacter aceti citrate synthase complexed with oxaloacetate and carboxymethyldethia coenzyme a (cmx) (see paper)
68% identity, 99% coverage: 6:428/429 of query aligns to 3:426/426 of 2h12B
3msuB Crystal structure of citrate synthase from francisella tularensis
57% identity, 95% coverage: 16:421/429 of query aligns to 23:425/426 of 3msuB
P9WPD5 Citrate synthase 1; EC 2.3.3.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
55% identity, 99% coverage: 3:428/429 of query aligns to 5:431/431 of P9WPD5
3msuA Crystal structure of citrate synthase from francisella tularensis
56% identity, 95% coverage: 16:421/429 of query aligns to 23:414/415 of 3msuA
4tvmA Structure of citrate synthase from mycobacterium tuberculosis (see paper)
50% identity, 96% coverage: 16:425/429 of query aligns to 11:380/380 of 4tvmA
6abwA Crystal structure of citrate synthase (msed_0281) from metallosphaera sedula in complex with acetyl-coa (see paper)
37% identity, 87% coverage: 55:428/429 of query aligns to 8:369/369 of 6abwA
6abyA Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with oxaloacetate (see paper)
34% identity, 89% coverage: 46:428/429 of query aligns to 6:370/372 of 6abyA
6abxA Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with citrate (see paper)
34% identity, 89% coverage: 46:428/429 of query aligns to 6:370/370 of 6abxA
P39120 Citrate synthase 2; Citrate synthase II; EC 2.3.3.16 from Bacillus subtilis (strain 168) (see paper)
36% identity, 89% coverage: 46:428/429 of query aligns to 9:371/372 of P39120
1iomA Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
36% identity, 89% coverage: 46:428/429 of query aligns to 4:374/374 of 1iomA
1ixeA Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
36% identity, 89% coverage: 46:428/429 of query aligns to 4:371/371 of 1ixeA
1aj8A Citrate synthase from pyrococcus furiosus (see paper)
34% identity, 88% coverage: 54:429/429 of query aligns to 12:371/371 of 1aj8A
O34002 2-methylcitrate synthase; 2-MCS; MCS; Citrate synthase; EC 2.3.3.5; EC 2.3.3.16 from Antarctic bacterium DS2-3R (see 2 papers)
33% identity, 89% coverage: 42:422/429 of query aligns to 5:378/379 of O34002
Sites not aligning to the query:
1a59A Cold-active citrate synthase (see paper)
33% identity, 89% coverage: 42:422/429 of query aligns to 3:376/377 of 1a59A
P39119 Citrate synthase 1; Citrate synthase I; EC 2.3.3.16 from Bacillus subtilis (strain 168) (see paper)
32% identity, 86% coverage: 46:416/429 of query aligns to 5:358/366 of P39119
>PP_4194 FitnessBrowser__Putida:PP_4194
MADKKAQLVIEGAAPVELPILTGTVGPDVIDVRGLGATGHFTFDPGFMATASCESKITYI
DGDKGILLHRGYPIEQLAEQSDYLETCYLLLNGELPNAEQKAQFVSTVKNHTMVHEQLKS
FFNGFRRDAHPMAVMCGVVGALSAFYHDSLDINNPQHREISAVRLVAKMPTLAAMVYKYS
MGQPMMYPRNDLSYAENFLHMMFNTPCEIKPISPVLAKAMDRIFILHADHEQNASTSTVR
LAGSSGANPFACIAAGIAALWGPAHGGANEAVLTMLDEIGDVSNIDKFIAKAKDKNDPFK
LMGFGHRVYKNRDPRATVMKQTCDEVLRELGIKNDPQLELAMRLEEIALTDPYFIERSLY
PNVDFYSGIILKAIGIPTSMFTVIFALARTVGWISHWKEMLSSPYKIGRPRQLYTGEQKR
DIVALKDRK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory