SitesBLAST
Comparing PP_4232 FitnessBrowser__Putida:PP_4232 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
Q47945 Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
38% identity, 98% coverage: 9:401/403 of query aligns to 21:434/478 of Q47945
- Q37 (vs. gap) modified: Pyrrolidone carboxylic acid
Sites not aligning to the query:
8gy2B Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
38% identity, 94% coverage: 23:401/403 of query aligns to 1:396/433 of 8gy2B
- binding heme c: C18 (= C40), C21 (= C43), H22 (= H44), T46 (≠ S68), I48 (= I70), Y59 (= Y81), L68 (≠ V90), R73 (= R95), V79 (≠ L101), Y80 (= Y102), M83 (= M105), F88 (≠ Y110), R126 (= R147), H165 (= H185), C166 (= C186), C169 (= C189), H170 (= H190), I201 (≠ L214), A202 (= A215), P203 (= P216), L205 (= L218), W216 (= W228), F224 (= F236), A234 (≠ S246), V235 (≠ M247), F236 (= F248), F236 (= F248), M239 (= M251), N301 (≠ V307), C302 (= C308), C305 (= C311), H306 (= H312), M316 (≠ I322), F317 (≠ A323), P318 (≠ V324), L320 (≠ M326), P324 (≠ T330), G342 (≠ I348), S352 (≠ R358), V354 (≠ Q360), M356 (= M362), F359 (= F365), M375 (≠ L381)
- binding ubiquinone-10: C21 (= C43), L34 (= L56), P39 (= P61), P81 (= P103), L129 (= L150), W132 (= W153), E168 (= E188), R173 (= R193), I197 (≠ L210), D241 (≠ P253)
Sites not aligning to the query:
7w2jC Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
36% identity, 93% coverage: 28:402/403 of query aligns to 1:387/418 of 7w2jC
- binding heme c: C13 (= C40), C16 (= C43), H17 (= H44), T42 (≠ S68), I44 (= I70), Y55 (= Y81), L75 (= L101), Y76 (= Y102), A78 (= A104), M79 (= M105), R122 (= R147), H161 (= H185), C162 (= C186), C165 (= C189), H166 (= H190), A191 (= A215), P192 (= P216), R223 (≠ S246), P227 (≠ E250), M228 (= M251), V289 (= V307), C290 (= C308), C293 (= C311), H294 (= H312), Y305 (≠ I322), Y306 (≠ A323), P307 (≠ V324), L309 (≠ M326), N312 (= N329), T313 (= T330), T314 (≠ V331), D322 (≠ N339), I327 (≠ V344), V331 (≠ I348), R333 (≠ Q351), I340 (≠ R358), M342 (≠ Q360), P343 (= P361), F345 (≠ P363)
8jejC Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
35% identity, 93% coverage: 28:402/403 of query aligns to 1:401/413 of 8jejC
- binding heme c: C13 (= C40), C16 (= C43), H17 (= H44), T42 (≠ S68), I44 (= I70), F60 (= F86), L64 (≠ V90), L75 (= L101), Y76 (= Y102), M79 (= M105), P80 (= P106), Y84 (= Y110), R122 (= R147), C162 (= C186), C165 (= C189), H166 (= H190), I186 (≠ L210), W189 (≠ Y213), A191 (= A215), P192 (= P216), I194 (≠ L218), W205 (= W228), Y213 (≠ F236), R223 (≠ S246), M228 (= M251), V303 (= V307), C304 (= C308), C307 (= C311), H308 (= H312), Y320 (≠ A323), P321 (≠ V324), L323 (≠ M326), T327 (= T330), T328 (≠ V331), D336 (≠ N339), I341 (≠ V344), V345 (≠ I348), R347 (≠ Q351), I354 (≠ R358), M356 (≠ Q360), F359 (≠ P363), I376 (≠ M377)
- binding ubiquinone-10: M36 (≠ F62), P77 (= P103), S124 (≠ G149), W128 (= W153), C165 (= C189), L173 (≠ G197)
Sites not aligning to the query:
8gy3A Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
32% identity, 95% coverage: 15:398/403 of query aligns to 32:424/440 of 8gy3A
- binding heme c: Y52 (≠ D39), C53 (= C40), C56 (= C43), H57 (= H44), S84 (= S68), I86 (= I70), W97 (≠ Y81), F102 (= F86), L117 (= L101), F121 (≠ M105), F126 (≠ Y110), R163 (= R147), C203 (= C186), C206 (= C189), H207 (= H190), A232 (= A215), P233 (= P216), L235 (= L218), W245 (= W228), Y253 (≠ F236), L254 (= L237), G263 (= G245), S264 (= S246), M269 (= M251), Y292 (≠ L274), C337 (= C308), C340 (= C311), H341 (= H312), P353 (= P320), L355 (≠ I322), N358 (= N329), N359 (≠ T330), V372 (= V343), I377 (= I348), G382 (= G355), Q383 (≠ F356), I386 (≠ M359), M388 (= M362), F391 (= F365)
- binding ubiquinone-10: E55 (≠ A42), T76 (≠ S60), F78 (= F62), Y118 (= Y102), P119 (= P103), I160 (≠ F144), G166 (= G149), Q167 (≠ L150), F169 (≠ G152), W170 (= W153), H202 (= H185), R210 (= R193), L213 (≠ I196)
8hddB Complex structure of catalytic, small, and a partial electron transfer subunits from burkholderia cepacia fad glucose dehydrogenase
31% identity, 24% coverage: 304:401/403 of query aligns to 26:121/121 of 8hddB
- binding protoporphyrin ix containing fe: C30 (= C308), C33 (= C311), H34 (= H312), Y46 (≠ A323), P47 (≠ V324), T54 (≠ V331), V66 (= V343), I67 (≠ V344), R73 (≠ Q352), I80 (≠ M359), M82 (= M362), P83 (= P363)
Query Sequence
>PP_4232 FitnessBrowser__Putida:PP_4232
MGFVRSASALALGLAVSSFALAADDAQVKRGEYLARAADCMACHTAEGGAPYAGGLPIHS
PFGTIYGSNITPDKQYGIGNYSADEFFAAVTEGKRKDGANLYPAMPYTSYHLIKREDSDA
ILAYLMTIPPINRPAPQTALRFPFNVRMGLSGWNMLYGKSVQLQPTEGKSPAWQRGQYMV
EVLGHCGECHTPRNPIGALQQDQRLSGGLLGGYLAPSLLAQDLAERGWTQPDLTTFLKHG
ISAQGSMFNEMFPVVHHSTQHLEDADLAAMATYLLGDQPPPAKAIESVALEQMSDSAKRG
HQQYLNVCAGCHGVDGEGKPHIAVAMRGNTVLRQADSRNLVKVVLEGIREQQFTGFERMQ
PMPGFADKLDDQQVIDMVNYLRQAWGGLPGDLNVQQLAELKAE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory