SitesBLAST
Comparing PP_4430 FitnessBrowser__Putida:PP_4430 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
34% identity, 93% coverage: 5:311/330 of query aligns to 23:329/339 of Q7XSN8
- E219 (≠ S204) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (≠ A210) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
36% identity, 83% coverage: 39:311/330 of query aligns to 40:312/322 of 3l6bA
- active site: K54 (= K53), S77 (≠ T78), E203 (≠ S204), A207 (≠ G208), D209 (≠ A210), G232 (≠ S232), T278 (≠ A281), L305 (≠ V304), S306 (= S305)
- binding malonate ion: K54 (= K53), S76 (= S77), S77 (≠ T78), N79 (= N80), H80 (= H81), R128 (≠ A129), G232 (≠ S232)
- binding manganese (ii) ion: E203 (≠ S204), A207 (≠ G208), D209 (≠ A210)
- binding pyridoxal-5'-phosphate: F53 (= F52), K54 (= K53), N79 (= N80), G178 (≠ S179), G179 (= G180), G180 (= G181), G181 (= G182), M182 (≠ L183), V233 (≠ L233), E276 (= E279), T278 (≠ A281), S306 (= S305), G307 (= G306)
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
36% identity, 82% coverage: 39:310/330 of query aligns to 39:310/310 of 7nbgDDD
- active site: K53 (= K53), S76 (≠ T78), E202 (≠ S204), A206 (≠ G208), D208 (≠ A210), G231 (≠ S232), L304 (≠ V304), S305 (= S305)
- binding calcium ion: E202 (≠ S204), A206 (≠ G208), D208 (≠ A210)
- binding magnesium ion: N239 (≠ R240)
- binding ortho-xylene: S76 (≠ T78), Q81 (≠ R83), I96 (≠ V98), Y113 (≠ L115)
- binding pyridoxal-5'-phosphate: F52 (= F52), K53 (= K53), N78 (= N80), G177 (≠ S179), G178 (= G180), G179 (= G181), G180 (= G182), M181 (≠ L183), G231 (≠ S232), V232 (≠ L233), E275 (= E279), T277 (≠ A281), S305 (= S305), G306 (= G306)
Sites not aligning to the query:
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
35% identity, 83% coverage: 39:311/330 of query aligns to 39:316/322 of 7nbgAAA
- active site: K53 (= K53), S81 (≠ T78), E207 (≠ S204), A211 (≠ G208), D213 (≠ A210), G236 (≠ S232), L309 (≠ V304), S310 (= S305)
- binding calcium ion: E207 (≠ S204), A211 (≠ G208), D213 (≠ A210)
- binding pyridoxal-5'-phosphate: F52 (= F52), K53 (= K53), N83 (= N80), G182 (≠ S179), G183 (= G180), G184 (= G181), G185 (= G182), M186 (≠ L183), G236 (≠ S232), V237 (≠ L233), T282 (≠ A281), S310 (= S305), G311 (= G306)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (≠ T78), G85 (= G82), Q86 (≠ R83), I101 (≠ V98), K111 (= K108), I115 (= I112), Y118 (≠ L115)
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
35% identity, 83% coverage: 39:311/330 of query aligns to 39:316/320 of 7nbhAAA
- active site: K53 (= K53), S81 (≠ T78), E207 (≠ S204), A211 (≠ G208), D213 (≠ A210), G236 (≠ S232), L309 (≠ V304), S310 (= S305)
- binding calcium ion: E207 (≠ S204), A211 (≠ G208), D213 (≠ A210)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (≠ T78), G85 (= G82), Q86 (≠ R83), K111 (= K108), I115 (= I112), Y118 (≠ L115), D235 (= D231), P281 (≠ G280), N313 (= N308), V314 (= V309), D315 (= D310)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
35% identity, 83% coverage: 39:311/330 of query aligns to 39:316/323 of 7nbfAAA
- active site: K53 (= K53), S81 (≠ T78), E207 (≠ S204), A211 (≠ G208), D213 (≠ A210), G236 (≠ S232), L309 (≠ V304), S310 (= S305)
- binding calcium ion: E207 (≠ S204), A211 (≠ G208), D213 (≠ A210)
- binding magnesium ion: N244 (≠ R240)
- binding pyridoxal-5'-phosphate: F52 (= F52), K53 (= K53), N83 (= N80), G182 (≠ S179), G183 (= G180), G184 (= G181), G185 (= G182), M186 (≠ L183), G236 (≠ S232), V237 (≠ L233), T282 (≠ A281), S310 (= S305), G311 (= G306)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: F46 (≠ H46)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
35% identity, 83% coverage: 39:311/330 of query aligns to 39:316/323 of 7nbdAAA
- active site: K53 (= K53), S81 (≠ T78), E207 (≠ S204), A211 (≠ G208), D213 (≠ A210), G236 (≠ S232), L309 (≠ V304), S310 (= S305)
- binding calcium ion: E207 (≠ S204), A211 (≠ G208), D213 (≠ A210)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ Y271), L278 (≠ V277), V314 (= V309), L316 (≠ M311)
- binding magnesium ion: N244 (≠ R240)
- binding pyridoxal-5'-phosphate: F52 (= F52), K53 (= K53), N83 (= N80), G182 (≠ S179), G183 (= G180), G184 (= G181), G185 (= G182), M186 (≠ L183), G236 (≠ S232), V237 (≠ L233), E280 (= E279), T282 (≠ A281), S310 (= S305), G311 (= G306)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
35% identity, 83% coverage: 39:311/330 of query aligns to 39:316/323 of 7nbcCCC
- active site: K53 (= K53), S81 (≠ T78), E207 (≠ S204), A211 (≠ G208), D213 (≠ A210), G236 (≠ S232), L309 (≠ V304), S310 (= S305)
- binding biphenyl-4-ylacetic acid: T78 (= T75), H79 (≠ A76), H84 (= H81), V148 (≠ I145), H149 (≠ P146), P150 (= P147)
- binding calcium ion: E207 (≠ S204), A211 (≠ G208), D213 (≠ A210)
- binding pyridoxal-5'-phosphate: F52 (= F52), K53 (= K53), N83 (= N80), G182 (≠ S179), G183 (= G180), G184 (= G181), G185 (= G182), M186 (≠ L183), G236 (≠ S232), V237 (≠ L233), T282 (≠ A281), S310 (= S305), G311 (= G306)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
35% identity, 83% coverage: 39:311/330 of query aligns to 39:316/323 of 7nbcAAA
- active site: K53 (= K53), S81 (≠ T78), E207 (≠ S204), A211 (≠ G208), D213 (≠ A210), G236 (≠ S232), L309 (≠ V304), S310 (= S305)
- binding calcium ion: E207 (≠ S204), A211 (≠ G208), D213 (≠ A210)
- binding magnesium ion: N244 (≠ R240)
- binding pyridoxal-5'-phosphate: F52 (= F52), K53 (= K53), N83 (= N80), G182 (≠ S179), G183 (= G180), G184 (= G181), G185 (= G182), M186 (≠ L183), G236 (≠ S232), V237 (≠ L233), T282 (≠ A281), S310 (= S305), G311 (= G306)
Sites not aligning to the query:
6zspAAA serine racemase bound to atp and malonate. (see paper)
36% identity, 83% coverage: 39:311/330 of query aligns to 39:309/320 of 6zspAAA
- active site: K53 (= K53), S74 (≠ T78), E200 (≠ S204), A204 (≠ G208), D206 (≠ A210), G229 (≠ S232), L302 (≠ V304), S303 (= S305)
- binding adenosine-5'-triphosphate: K48 (≠ A48), T49 (= T49), Q79 (≠ R83), Y111 (≠ L115), E266 (≠ L272), R267 (≠ E273), K269 (≠ R275), N306 (= N308)
- binding magnesium ion: E200 (≠ S204), A204 (≠ G208), D206 (≠ A210)
- binding malonate ion: K53 (= K53), S73 (= S77), S74 (≠ T78), N76 (= N80), H77 (= H81), R125 (≠ A129), G229 (≠ S232), S232 (≠ G235)
Sites not aligning to the query:
2gn2A Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) (see paper)
35% identity, 95% coverage: 4:317/330 of query aligns to 7:321/326 of 2gn2A
- active site: K56 (= K53), A81 (≠ T78), Q207 (≠ S204), V211 (≠ G208), G213 (≠ A210), G235 (= G234), I308 (≠ V304), S309 (= S305)
- binding cytidine-5'-monophosphate: R51 (≠ A48), T52 (= T49), G53 (= G50), A114 (= A111), D117 (≠ A114), Y118 (≠ L115), N312 (= N308)
5cvcA Structure of maize serine racemase (see paper)
34% identity, 93% coverage: 5:311/330 of query aligns to 7:313/329 of 5cvcA
- active site: K52 (= K53), S77 (≠ T78), E203 (≠ S204), A207 (≠ G208), D209 (≠ A210), G231 (≠ S232), V306 (= V304), S307 (= S305)
- binding magnesium ion: E203 (≠ S204), A207 (≠ G208), D209 (≠ A210)
- binding pyridoxal-5'-phosphate: F51 (= F52), K52 (= K53), N79 (= N80), S178 (= S179), G179 (= G180), G180 (= G181), G181 (= G182), L232 (= L233), E275 (= E279), S307 (= S305), G308 (= G306)
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
37% identity, 81% coverage: 23:289/330 of query aligns to 28:292/494 of 1tdjA
- active site: K58 (= K53), A83 (≠ T78), E209 (≠ S204), S213 (≠ G208), C215 (≠ A210), G237 (= G234)
- binding pyridoxal-5'-phosphate: F57 (= F52), K58 (= K53), N85 (= N80), G184 (≠ S179), G185 (= G180), G186 (= G181), G187 (= G182), G237 (= G234), E282 (= E279)
Sites not aligning to the query:
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
37% identity, 81% coverage: 23:289/330 of query aligns to 32:296/514 of P04968
- K62 (= K53) modified: N6-(pyridoxal phosphate)lysine
- N89 (= N80) binding
- GGGGL 188:192 (≠ SGGGL 179:183) binding
Sites not aligning to the query:
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
31% identity, 95% coverage: 5:318/330 of query aligns to 9:321/323 of O59791
- S82 (≠ T78) mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
31% identity, 95% coverage: 5:318/330 of query aligns to 4:316/318 of 1wtcA
- active site: K52 (= K53), S77 (≠ T78), E203 (≠ S204), G207 (= G208), D209 (≠ A210), G231 (= G234), I302 (≠ V304), S303 (= S305)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ R21), K47 (≠ A48), M48 (≠ T49), A109 (= A110), A110 (= A111), Y114 (≠ L115)
- binding magnesium ion: E203 (≠ S204), G207 (= G208), D209 (≠ A210)
- binding pyridoxal-5'-phosphate: F51 (= F52), K52 (= K53), N79 (= N80), G178 (≠ S179), G179 (= G180), G180 (= G181), G181 (= G182), G231 (= G234), E276 (= E279), T278 (≠ A281), S303 (= S305)
1v71A Crystal structure of s.Pombe serine racemase
31% identity, 95% coverage: 5:318/330 of query aligns to 4:316/318 of 1v71A
- active site: K52 (= K53), S77 (≠ T78), E203 (≠ S204), G207 (= G208), D209 (≠ A210), G231 (= G234), I302 (≠ V304), S303 (= S305)
- binding magnesium ion: E203 (≠ S204), G207 (= G208), D209 (≠ A210)
- binding pyridoxal-5'-phosphate: F51 (= F52), K52 (= K53), N79 (= N80), G178 (≠ S179), G179 (= G180), G180 (= G181), G181 (= G182), G231 (= G234), E276 (= E279), T278 (≠ A281), S303 (= S305), G304 (= G306)
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
31% identity, 95% coverage: 5:318/330 of query aligns to 5:317/319 of 2zr8A
- active site: K53 (= K53), S78 (≠ T78), E204 (≠ S204), G208 (= G208), D210 (≠ A210), G232 (= G234), I303 (≠ V304), S304 (= S305)
- binding magnesium ion: E204 (≠ S204), G208 (= G208), D210 (≠ A210)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F52), K53 (= K53), S77 (= S77), S78 (≠ T78), N80 (= N80), H81 (= H81), P147 (= P147), G179 (≠ S179), G180 (= G180), G181 (= G181), G182 (= G182), G232 (= G234), E277 (= E279), T279 (≠ A281), S304 (= S305)
- binding serine: S78 (≠ T78), R129 (≠ A129), D231 (= D231), G232 (= G234), A233 (≠ G235), Q234 (≠ G236), T235 (≠ I237)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
31% identity, 95% coverage: 5:318/330 of query aligns to 5:317/319 of 2zpuA
- active site: K53 (= K53), S78 (≠ T78), E204 (≠ S204), G208 (= G208), D210 (≠ A210), G232 (= G234), I303 (≠ V304), S304 (= S305)
- binding magnesium ion: E204 (≠ S204), G208 (= G208), D210 (≠ A210)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F52), K53 (= K53), S77 (= S77), S78 (≠ T78), N80 (= N80), H81 (= H81), P147 (= P147), G179 (≠ S179), G180 (= G180), G181 (= G181), G182 (= G182), G232 (= G234), E277 (= E279), T279 (≠ A281), S304 (= S305)
Q9QZX7 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Mus musculus (Mouse) (see paper)
36% identity, 83% coverage: 39:311/330 of query aligns to 42:319/339 of Q9QZX7
- C113 (≠ N107) modified: S-nitrosocysteine; mutation to S: Abolishes S-nitrosylation.
Query Sequence
>PP_4430 FitnessBrowser__Putida:PP_4430
MPAVTVREALIARDRIKHLVRETRMELSPSLSDFMKVPVYLKLECHQATGSFKLRGATNA
IAGLTSQQRALGVVTASTGNHGRALSYAAAAAGVRATVCLSRLVPSNKVAAIRALGAAVQ
VVGNSQDDAQFEAARLAQEEGLTFIPPFDHQDVIAGQATLGLEIAEQLPSVSQVLIPLSG
GGLFSGVSLALKALLPQVKTHGVSMRLGAAMAQSLEAGKPVNVEEVATLADSLGGGIGLR
NQYTFELTRRFIDRVILLNEDSIADAMLHAYLEERLVIEGAGAVGIAALLTRQVEAQGPI
VIVVSGGNVDMAQHQRIILEAVRDRRPARA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory