Comparing PP_4453 FitnessBrowser__Putida:PP_4453 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
36% identity, 43% coverage: 12:271/610 of query aligns to 3:267/330 of P0AAH4
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
36% identity, 44% coverage: 12:280/610 of query aligns to 4:272/326 of Q8RDH4
Sites not aligning to the query:
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
37% identity, 42% coverage: 12:266/610 of query aligns to 3:257/310 of 4fwiB
Sites not aligning to the query:
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
36% identity, 42% coverage: 12:266/610 of query aligns to 3:247/253 of 7z15I
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
36% identity, 42% coverage: 12:266/610 of query aligns to 3:247/250 of 7z18I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
36% identity, 42% coverage: 12:266/610 of query aligns to 3:247/250 of 7z16I
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 48% coverage: 12:302/610 of query aligns to 1:288/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
32% identity, 48% coverage: 12:302/610 of query aligns to 2:289/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
32% identity, 48% coverage: 12:302/610 of query aligns to 2:289/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
32% identity, 48% coverage: 12:302/610 of query aligns to 2:289/344 of 6cvlD
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
36% identity, 40% coverage: 319:559/610 of query aligns to 6:239/240 of 4ymuJ
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
36% identity, 38% coverage: 330:561/610 of query aligns to 17:248/375 of 2d62A
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
32% identity, 40% coverage: 11:257/610 of query aligns to 2:236/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
32% identity, 40% coverage: 11:257/610 of query aligns to 2:236/592 of 5lj7A
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
36% identity, 38% coverage: 330:559/610 of query aligns to 13:239/241 of 4u00A
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
32% identity, 38% coverage: 327:557/610 of query aligns to 34:264/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
32% identity, 38% coverage: 327:557/610 of query aligns to 34:264/382 of 7aheC
Sites not aligning to the query:
1g291 Malk (see paper)
35% identity, 39% coverage: 327:561/610 of query aligns to 11:245/372 of 1g291
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
34% identity, 39% coverage: 325:559/610 of query aligns to 9:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
34% identity, 39% coverage: 325:559/610 of query aligns to 9:241/242 of 3c41J
>PP_4453 FitnessBrowser__Putida:PP_4453
MNGSLPLNQETVLEVTGLNVAFRRGGGWSPVVKDLSFRVARGETLAIVGESGSGKSVSAM
SILGLLPANTSQVTGSIRLQGQELLCLPEPEMADIRGNRIAMIFQEPMTSLNPVMTIGEQ
IAEPLRLHRGLDATQAKEEALKLMERVRIPAAQERYDDYPHQFSGGMRQRVMIAMALACN
PAVLIADEPTTALDVTIQAQILELIKELQAQEHMAVVFITHDMGVVAQIADRTLVMYRGD
LVETASTSEIFSAPQKPYTKALLSAVPELGSMAAEPSPKPFPIYDMAAGSNVPAPEMKDS
VRHTKPYLLEVSGLTTRFDVRSGFFKRVTGRVHAVENVSFNLSQGETLAIVGESGCGKST
TGRLITGLLDPTHGSVKLEGVELGSITPMERARKIQMVFQDPYSSLNPRQTVAQSIIEPL
RVHGLYDAKRCEEVAIELLVKVGLPADAAWRLPHEFSGGQRQRVCIARALALRPGTIVAD
EAVSALDVSVKVQIVNLLLELQQELGLGFIFISHDMAVVERVSHRVAVMYMGEIVEIGPR
AAIFNDPKHPYTRRLIDAVPIPDPARKQVQRVSAGTLRTPYKAHDFIPPARVYHQAGEGH
FYMEPEGEWC
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory