Comparing PP_4463 FitnessBrowser__Putida:PP_4463 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q94JV5 Deaminated glutathione amidase, chloroplastic/cytosolic; dGSH amidase; Nitrilase-like protein 2; Protein nitrilase 1 homolog; AtNit1; Protein Nit1 homolog; EC 3.5.1.128 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
40% identity, 99% coverage: 1:270/273 of query aligns to 37:303/307 of Q94JV5
Sites not aligning to the query:
Q9NQR4 Omega-amidase NIT2; Nitrilase homolog 2; EC 3.5.1.3 from Homo sapiens (Human) (see 2 papers)
35% identity, 99% coverage: 1:269/273 of query aligns to 4:264/276 of Q9NQR4
P47016 Deaminated glutathione amidase; dGSH amidase; Nitrilase homolog 1; EC 3.5.1.128 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
34% identity, 98% coverage: 2:269/273 of query aligns to 7:301/307 of P47016
4hg5A Structural insights into yeast nit2: wild-type yeast nit2 in complex with oxaloacetate (see paper)
34% identity, 98% coverage: 2:269/273 of query aligns to 4:298/304 of 4hg5A
4hg3A Structural insights into yeast nit2: wild-type yeast nit2 in complex with alpha-ketoglutarate (see paper)
34% identity, 98% coverage: 2:269/273 of query aligns to 4:298/304 of 4hg3A
4hgdA Structural insights into yeast nit2: c169s mutant of yeast nit2 in complex with an endogenous peptide-like ligand (see paper)
33% identity, 98% coverage: 2:269/273 of query aligns to 3:294/299 of 4hgdA
Q9UYV8 Nitrilase; PaNit; EC 3.5.5.1 from Pyrococcus abyssi (strain GE5 / Orsay) (see paper)
31% identity, 89% coverage: 1:242/273 of query aligns to 2:225/262 of Q9UYV8
3klcB Crystal structure of hyperthermophilic nitrilase (see paper)
31% identity, 89% coverage: 1:242/273 of query aligns to 1:224/261 of 3klcB
Sites not aligning to the query:
3klcA Crystal structure of hyperthermophilic nitrilase (see paper)
31% identity, 89% coverage: 1:242/273 of query aligns to 1:224/261 of 3klcA
5h8jB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine (see paper)
27% identity, 95% coverage: 3:260/273 of query aligns to 7:270/297 of 5h8jB
5h8iC Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine (see paper)
28% identity, 95% coverage: 3:260/273 of query aligns to 11:274/301 of 5h8iC
7ovgA The c146a variant of an amidase from pyrococcus horikoshii with bound acetamide (see paper)
28% identity, 100% coverage: 1:272/273 of query aligns to 3:247/263 of 7ovgA
6ypaB The c146a variant of an amidase from pyrococcus horikoshii with bound glutaramide
28% identity, 100% coverage: 1:272/273 of query aligns to 9:253/269 of 6ypaB
5h8lB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine (see paper)
27% identity, 95% coverage: 3:260/273 of query aligns to 8:271/298 of 5h8lB
P46011 Bifunctional nitrilase/nitrile hydratase NIT4; Cyanoalanine nitrilase; Nitrilase 4; EC 3.5.5.1; EC 3.5.5.4; EC 4.2.1.65 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 77% coverage: 1:210/273 of query aligns to 36:248/355 of P46011
O25067 Aliphatic amidase; Acylamide amidohydrolase; EC 3.5.1.4 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
25% identity, 97% coverage: 9:273/273 of query aligns to 29:281/339 of O25067
O25836 Formamidase; Formamide amidohydrolase; EC 3.5.1.49 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
25% identity, 82% coverage: 8:231/273 of query aligns to 26:237/334 of O25836
2e2lA Helicobacter pylori formamidase amif contains a fine-tuned cysteine- glutamate-lysine catalytic triad (see paper)
25% identity, 86% coverage: 8:242/273 of query aligns to 14:247/317 of 2e2lA
Q44185 N-carbamoyl-D-amino acid hydrolase; D-N-alpha-carbamilase; EC 3.5.1.77 from Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter) (see paper)
27% identity, 63% coverage: 93:263/273 of query aligns to 106:286/304 of Q44185
Q9UBR1 Beta-ureidopropionase; BUP-1; Beta-alanine synthase; N-carbamoyl-beta-alanine amidohydrolase; EC 3.5.1.6 from Homo sapiens (Human) (see 4 papers)
26% identity, 64% coverage: 57:232/273 of query aligns to 139:322/384 of Q9UBR1
Sites not aligning to the query:
>PP_4463 FitnessBrowser__Putida:PP_4463
MKVSLIQVNSVQDKAFNLAEADRLAREAIDRDGSRLVVFPEHFDWAGGTPEQKIAAGEPH
SGGPAYEMCKKLAQDCNVYVHTGSFYESTPDGSRVYNTSVVFDPKGNELGRYRKIHLFDI
VTPDGMRYGESSAVAPGTEVSVVDIEGLKYGFAICYDIRFPELFQKLVALGADVIVLPAA
FTLQTGKDHWDVLCRARAIETQCYFLAPGQTGPFEQSGETRYSYGHSLVCDPWGHIIAKA
SDGVGYVTANIEPERIAAVRKQIPLASHKVLQK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory