Comparing PP_4475 FitnessBrowser__Putida:PP_4475 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
1yw4A Crystal structure of the succinylglutamate desuccinylase from chromobacterium violaceum, northeast structural genomics target cvr22.
46% identity, 91% coverage: 25:328/335 of query aligns to 23:314/319 of 1yw4A
2bcoA X-ray structure of succinylglutamate desuccinalase from vibrio parahaemolyticus (rimd 2210633) at the resolution 2.3 a, northeast structural genomics target vpr14
33% identity, 95% coverage: 11:327/335 of query aligns to 11:324/338 of 2bcoA
>PP_4475 FitnessBrowser__Putida:PP_4475
MLALGKLLELTLTDHEPAEKTQVTPKGARLRWLGEGALEVRPAESDDCGLDLLLSAGIHG
NETAPIELLERLLHGVANGKIRPRARVLFLFGNPAAIRKGERFIEQDINRLFNGRHELSS
GFEALRAAELEQFARVFFSKPGRNRLHYDLHTAIRGSKIEQFALYPYKEGRKHSRRELAR
LAAAGMEAVLLQSKSSITFSAFTYEQLEAEAFTLELGKARPFGQNEQVNLDKLEERLIRI
IEATEPEDESSLDGLQLFSVSREIIKHSDSFHLHLPADIENFSELSKGYLLAEDLAEMRW
VVEEEGARIIFPNPKVKNGLRAGILIVPDSGQRLG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory