SitesBLAST
Comparing PP_4478 FitnessBrowser__Putida:PP_4478 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ju8A Crystal structure of succinylglutamic semialdehyde dehydrogenase from pseudomonas aeruginosa.
82% identity, 100% coverage: 1:485/487 of query aligns to 2:486/486 of 3ju8A
- active site: N147 (= N146), K170 (= K169), E245 (= E244), C279 (= C278), E377 (= E376), P455 (≠ A454)
- binding nicotinamide-adenine-dinucleotide: G144 (= G143), Y146 (= Y145), N147 (= N146), L152 (= L151), K170 (= K169), S172 (= S171), F220 (= F219), T221 (= T220), G222 (= G221), S223 (= S222), T226 (= T225), E245 (= E244), M246 (= M245), G247 (= G246), C279 (= C278), E377 (= E376), F379 (= F378), F444 (= F443)
5u0mA Fatty aldehyde dehydrogenase from marinobacter aquaeolei vt8 and cofactor complex (see paper)
62% identity, 99% coverage: 5:487/487 of query aligns to 7:488/488 of 5u0mA
- active site: N148 (= N146), K171 (= K169), E246 (= E244), C280 (= C278), E377 (= E376), P455 (≠ A454)
- binding nicotinamide-adenine-dinucleotide: F144 (= F142), Y147 (= Y145), N148 (= N146), K171 (= K169), S173 (= S171), E174 (= E172), G207 (= G205), T222 (= T220), G223 (= G221), S224 (= S222), V227 (≠ T225), E246 (= E244), M247 (= M245), G248 (= G246), C280 (= C278), E377 (= E376), F379 (= F378)
5u0lA X-ray crystal structure of fatty aldehyde dehydrogenase enzymes from marinobacter aquaeolei vt8 complexed with a substrate (see paper)
62% identity, 99% coverage: 5:487/487 of query aligns to 7:488/488 of 5u0lA
- active site: N148 (= N146), K171 (= K169), E246 (= E244), C280 (= C278), E377 (= E376), P455 (≠ A454)
- binding decanal: K107 (= K105), H152 (= H150), L153 (= L151), G156 (= G154), H157 (= H155), S456 (= S455), A457 (= A456)
5izdA Wild-type glyceraldehyde dehydrogenase from thermoplasma acidophilum in complex with NADP
31% identity, 84% coverage: 2:410/487 of query aligns to 3:415/494 of 5izdA
- active site: N149 (= N146), K172 (= K169), E247 (= E244), C281 (= C278), E381 (= E376)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L145 (≠ F142), T146 (≠ G143), W148 (≠ Y145), K172 (= K169), P173 (= P170), S174 (= S171), S175 (≠ E172), R204 (vs. gap), G205 (≠ A201), G209 (= G205), D210 (≠ V206), G225 (= G221), S226 (= S222), T229 (= T225)
Sites not aligning to the query:
3jz4A Crystal structure of e. Coli NADP dependent enzyme (see paper)
33% identity, 94% coverage: 6:462/487 of query aligns to 14:471/481 of 3jz4A
- active site: N156 (= N146), K179 (= K169), E254 (= E244), C288 (= C278), E385 (= E376), E462 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: P154 (= P144), W155 (≠ Y145), K179 (= K169), A181 (≠ S171), S182 (≠ E172), A212 (= A201), G216 (= G205), G232 (= G221), S233 (= S222), I236 (≠ T225), C288 (= C278), K338 (≠ A330), E385 (= E376), F387 (= F378)
P25526 Succinate-semialdehyde dehydrogenase [NADP(+)] GabD; SSDH; Glutarate-semialdehyde dehydrogenase; EC 1.2.1.79; EC 1.2.1.- from Escherichia coli (strain K12) (see paper)
33% identity, 94% coverage: 6:462/487 of query aligns to 15:472/482 of P25526
4o6rA Crystal structure of a putative aldehyde dehydrogenase from burkholderia cenocepacia
33% identity, 92% coverage: 17:463/487 of query aligns to 20:470/489 of 4o6rA
- active site: N150 (= N146), K173 (= K169), E248 (= E244), C282 (= C278), E383 (= E376), E460 (≠ A454)
- binding adenosine monophosphate: I146 (≠ F142), V147 (≠ G143), K173 (= K169), G206 (≠ R202), G210 (= G205), Q211 (≠ V206), F224 (= F219), G226 (= G221), S227 (= S222), T230 (= T225), R233 (≠ L228)
4cazA Crystal structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa in complex with nadh
31% identity, 92% coverage: 5:453/487 of query aligns to 9:462/489 of 4cazA
- active site: N152 (= N146), K175 (= K169), E251 (= E244), C285 (= C278), E386 (= E376)
- binding [[(2R,3S,4R,5R)-5-[(3R)-3-aminocarbonyl-3,4-dihydro-2H-pyridin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanidyl-phosphoryl] [(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl phosphate: I148 (≠ F142), G149 (= G143), W151 (≠ Y145), N152 (= N146), K175 (= K169), E178 (= E172), G208 (vs. gap), G212 (= G205), F226 (= F219), T227 (= T220), G228 (= G221), G229 (≠ S222), T232 (= T225), V236 (≠ L229), E251 (= E244), L252 (≠ M245), C285 (= C278), E386 (= E376), F388 (= F378)
Sites not aligning to the query:
2woxA Betaine aldehyde dehydrogenase from pseudomonas aeruginosa with NAD(p) h-catalytic thiol adduct. (see paper)
31% identity, 92% coverage: 5:453/487 of query aligns to 9:462/489 of 2woxA
- active site: N152 (= N146), K175 (= K169), E251 (= E244), C285 (= C278), E386 (= E376)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I148 (≠ F142), G149 (= G143), W151 (≠ Y145), N152 (= N146), K175 (= K169), S177 (= S171), E178 (= E172), G208 (vs. gap), G212 (= G205), F226 (= F219), T227 (= T220), G228 (= G221), G229 (≠ S222), T232 (= T225), V236 (≠ L229), E251 (= E244), L252 (≠ M245), C285 (= C278), E386 (= E376), F388 (= F378)
Sites not aligning to the query:
2wmeA Crystallographic structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa (see paper)
31% identity, 92% coverage: 5:453/487 of query aligns to 9:462/489 of 2wmeA
- active site: N152 (= N146), K175 (= K169), E251 (= E244), C285 (= C278), E386 (= E376)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G149 (= G143), W151 (≠ Y145), K175 (= K169), S177 (= S171), E178 (= E172), G208 (vs. gap), G212 (= G205), F226 (= F219), G228 (= G221), G229 (≠ S222), T232 (= T225), V236 (≠ L229)
Sites not aligning to the query:
Q9HTJ1 NAD/NADP-dependent betaine aldehyde dehydrogenase; BADH; EC 1.2.1.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
31% identity, 92% coverage: 5:453/487 of query aligns to 10:463/490 of Q9HTJ1
- GAWN 150:153 (≠ GPYN 143:146) binding
- K162 (≠ H155) active site, Charge relay system
- KPSE 176:179 (= KPSE 169:172) binding
- G209 (vs. gap) binding
- GTST 230:233 (≠ SSRT 222:225) binding
- E252 (= E244) active site, Proton acceptor
- C286 (= C278) binding covalent; modified: Cysteine sulfenic acid (-SOH)
- E387 (= E376) binding
Sites not aligning to the query:
- 464 active site, Charge relay system
2d4eC Crystal structure of the hpcc from thermus thermophilus hb8
31% identity, 97% coverage: 4:477/487 of query aligns to 29:505/515 of 2d4eC
- active site: N173 (= N146), K196 (= K169), E271 (= E244), C305 (= C278), E409 (= E376), E486 (≠ A454)
- binding nicotinamide-adenine-dinucleotide: I169 (≠ F142), T170 (≠ G143), P171 (= P144), W172 (≠ Y145), K196 (= K169), A198 (≠ S171), G229 (≠ A201), G233 (= G205), A234 (≠ V206), T248 (= T220), G249 (= G221), E250 (≠ S222), T253 (= T225), E271 (= E244), L272 (≠ M245), C305 (= C278), E409 (= E376), F411 (= F378), F475 (= F443)
Q9H2A2 2-aminomuconic semialdehyde dehydrogenase; Aldehyde dehydrogenase 12; Aldehyde dehydrogenase family 8 member A1; EC 1.2.1.32 from Homo sapiens (Human) (see paper)
30% identity, 95% coverage: 1:462/487 of query aligns to 9:476/487 of Q9H2A2
- R109 (≠ S101) mutation to A: About 65-fold loss of catalytic efficiency.
- N155 (= N146) mutation to A: Complete loss of activity.
- R451 (≠ A437) mutation to A: Complete loss of activity.
6wsbA Crystal structure of a betaine aldehyde dehydrogenase from burkholderia pseudomallei bound to cofactor NAD (see paper)
32% identity, 92% coverage: 5:453/487 of query aligns to 9:461/489 of 6wsbA
- active site: N152 (= N146), E250 (= E244), C284 (= C278)
- binding nicotinamide-adenine-dinucleotide: I148 (≠ F142), G149 (= G143), A150 (≠ P144), W151 (≠ Y145), N152 (= N146), K175 (= K169), E178 (= E172), G208 (≠ R202), G211 (= G205), A212 (≠ V206), F225 (= F219), T226 (= T220), G227 (= G221), G228 (≠ S222), T231 (= T225), V235 (≠ L229), E250 (= E244), L251 (≠ M245), G252 (= G246), C284 (= C278), E385 (= E376), F387 (= F378)
Sites not aligning to the query:
4yweA Crystal structure of a putative aldehyde dehydrogenase from burkholderia cenocepacia
32% identity, 94% coverage: 4:459/487 of query aligns to 3:461/476 of 4yweA
5iuwA Crystal structure of indole-3-acetaldehyde dehydrogenase in complexed with NAD+ and iaa (see paper)
32% identity, 94% coverage: 5:461/487 of query aligns to 21:483/495 of 5iuwA
- active site: N166 (= N146), K189 (= K169), E265 (= E244), C300 (= C278), E399 (= E376), D476 (≠ A454)
- binding 1h-indol-3-ylacetic acid: F167 (= F147), M170 (≠ H150), C300 (= C278), D457 (≠ T435), F465 (= F443)
- binding nicotinamide-adenine-dinucleotide: I162 (≠ F142), V163 (≠ G143), P164 (= P144), W165 (≠ Y145), N166 (= N146), K189 (= K169), G222 (≠ R202), G226 (= G205), K227 (≠ V206), F240 (= F219), T241 (= T220), G242 (= G221), S243 (= S222), I246 (≠ T225), Y253 (≠ F233), E265 (= E244), A266 (≠ M245), C300 (= C278), E399 (= E376), F401 (= F378)
5iuvA Crystal structure of indole-3-acetaldehyde dehydrogenase in complexed with NAD+ (see paper)
32% identity, 94% coverage: 5:461/487 of query aligns to 21:483/495 of 5iuvA
- active site: N166 (= N146), K189 (= K169), E265 (= E244), C300 (= C278), E399 (= E376), D476 (≠ A454)
- binding nicotinamide-adenine-dinucleotide: I162 (≠ F142), V163 (≠ G143), P164 (= P144), W165 (≠ Y145), N166 (= N146), K189 (= K169), S191 (= S171), G222 (≠ R202), G226 (= G205), K227 (≠ V206), F240 (= F219), T241 (= T220), G242 (= G221), S243 (= S222), I246 (≠ T225), Y253 (≠ F233), E265 (= E244), A266 (≠ M245), C300 (= C278), E399 (= E376), F401 (= F378)
2eiwA Crystal analysis of delta1-pyrroline-5-carboxylate dehydrogenase from thermus thermophilus with bound l-proline
31% identity, 94% coverage: 5:463/487 of query aligns to 41:503/516 of 2eiwA
- active site: N184 (= N146), K207 (= K169), E288 (= E244), C322 (= C278), E417 (= E376), T497 (≠ S455)
- binding proline: E137 (≠ S101), F185 (= F147), S323 (≠ T279), G477 (= G436), A478 (= A437), F485 (= F443)
4go4A Crystal structure of pnpe in complex with nicotinamide adenine dinucleotide
32% identity, 94% coverage: 5:462/487 of query aligns to 6:467/487 of 4go4A
- active site: N149 (= N146), K172 (= K169), E247 (= E244), C281 (= C278), E381 (= E376), E458 (≠ A454)
- binding nicotinamide-adenine-dinucleotide: I145 (≠ F142), V146 (≠ G143), W148 (≠ Y145), N149 (= N146), F154 (≠ L151), K172 (= K169), G205 (≠ R202), G209 (= G205), Q210 (≠ V206), F223 (= F219), T224 (= T220), G225 (= G221), S226 (= S222), T229 (= T225), E247 (= E244), G249 (= G246), C281 (= C278), E381 (= E376), F383 (= F378)
2j5nA 1-pyrroline-5-carboxylate dehydrogenase from thermus thermophirus with bound inhibitor glycine and NAD.
31% identity, 94% coverage: 5:463/487 of query aligns to 41:503/516 of 2j5nA
- active site: N184 (= N146), K207 (= K169), E288 (= E244), C322 (= C278), E417 (= E376), T497 (≠ S455)
- binding glycine: S323 (≠ T279), G477 (= G436), A478 (= A437), F485 (= F443)
- binding nicotinamide-adenine-dinucleotide: I180 (≠ F142), A181 (≠ G143), P182 (= P144), W183 (≠ Y145), N184 (= N146), I189 (≠ L151), K207 (= K169), E210 (= E172), G240 (≠ A201), F258 (= F219), T259 (= T220), G260 (= G221), S261 (= S222), V264 (≠ T225), E288 (= E244), T289 (≠ M245), C322 (= C278), E417 (= E376), F419 (= F378)
Query Sequence
>PP_4478 FitnessBrowser__Putida:PP_4478
MTTHYIAGNWQAGQGETLQSLNPVTQAVIWQGQGADASQVDAAVQAARQAFPAWAQLSLE
ARIDVLEKFAAQLKVHAEAMAQCIGEETGKPLWESATEVTSMINKVAISVQSYRERTGEK
SGPLADATAVLRHKPHGVVAVFGPYNFPGHLPNGHIVPALLAGNCVVFKPSELTPKVAEL
TVNCWIAAGLPAGVLNLVQGARETGVALAANPGIDGLFFTGSSRTGNLLHQQFAGRPDKI
LALEMGGNNPLVVDEVKDLDAAVYTIIQSAFISAGQRCTCARRLLVPQGAWGDALIARLV
EVCKTITVGAFDEQPAPFMGSVISLQAARALLAAQVELAAKGGVKLLEMTQPQADAALLT
PGIVDVTAVADRPDEEFFGPLLQVIRYADFDAAIDEANNTQYGLAAGLLSDSRARYQYFW
LRSRAGIVNWNKQLTGAASSAPFGGVGASGNHRASAYYAADYCAYPVASLETASLALPAT
LTPGVTL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory