Comparing PP_4594 FitnessBrowser__Putida:PP_4594 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4iyoD Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
51% identity, 96% coverage: 11:387/393 of query aligns to 3:380/384 of 4iyoD
4iyoB Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
51% identity, 96% coverage: 11:387/393 of query aligns to 3:380/381 of 4iyoB
4iy7B Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
51% identity, 96% coverage: 11:387/393 of query aligns to 3:380/381 of 4iy7B
4iy7A Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
51% identity, 96% coverage: 11:387/393 of query aligns to 3:380/381 of 4iy7A
4ixzA Native structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae at ph 9.0 (see paper)
51% identity, 96% coverage: 11:387/393 of query aligns to 3:380/381 of 4ixzA
4ixsB Native structure of xometc at ph 5.2 (see paper)
51% identity, 96% coverage: 11:387/393 of query aligns to 2:371/372 of 4ixsB
6k1lB E53a mutant of a putative cystathionine gamma-lyase (see paper)
50% identity, 96% coverage: 12:388/393 of query aligns to 5:382/382 of 6k1lB
6k1lA E53a mutant of a putative cystathionine gamma-lyase (see paper)
50% identity, 96% coverage: 12:388/393 of query aligns to 5:382/382 of 6k1lA
7ba4A Structure of cystathionine gamma-lyase from pseudomonas aeruginosa
48% identity, 97% coverage: 7:387/393 of query aligns to 1:371/377 of 7ba4A
6cjaA Crystal structure of cystathionine beta-lyase from legionella pneumophila philadelphia 1 in complex with alanyl-plp and serine
44% identity, 96% coverage: 11:387/393 of query aligns to 3:380/381 of 6cjaA
7d7oB Crystal structure of cystathionine gamma-lyase from bacillus cereus atcc 14579 (see paper)
43% identity, 95% coverage: 14:387/393 of query aligns to 5:376/377 of 7d7oB
8j6nA Crystal structure of cystathionine gamma-lyase in complex with compound 1 (see paper)
45% identity, 97% coverage: 10:389/393 of query aligns to 7:387/390 of 8j6nA
5m3zA Crystal structure of citrobacter freundii methionine gamma-lyase with c115h replacement in the complex with l-norleucine (see paper)
41% identity, 96% coverage: 12:388/393 of query aligns to 7:392/395 of 5m3zA
4omaA The crystal structure of methionine gamma-lyase from citrobacter freundii in complex with l-cycloserine pyridoxal-5'-phosphate (see paper)
41% identity, 96% coverage: 12:388/393 of query aligns to 8:393/396 of 4omaA
3jwbA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with norleucine (see paper)
41% identity, 96% coverage: 12:388/393 of query aligns to 8:393/396 of 3jwbA
3jwaA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with methionine phosphinate (see paper)
41% identity, 96% coverage: 12:388/393 of query aligns to 8:393/396 of 3jwaA
3jw9A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with s-ethyl-cysteine (see paper)
41% identity, 96% coverage: 12:388/393 of query aligns to 8:393/396 of 3jw9A
6egrA Crystal structure of citrobacter freundii methionine gamma-lyase with v358y replacement (see paper)
41% identity, 96% coverage: 12:388/393 of query aligns to 8:393/396 of 6egrA
4hf8A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with glycine (see paper)
41% identity, 96% coverage: 12:388/393 of query aligns to 8:393/396 of 4hf8A
4l0oH Structure determination of cystathionine gamma-synthase from helicobacter pylori
43% identity, 95% coverage: 14:387/393 of query aligns to 5:370/373 of 4l0oH
>PP_4594 FitnessBrowser__Putida:PP_4594
MGLTMSDKPRNFATRTIHAGEQFSVADNAIFPAIVTASSFTKRSLDDKPEYSYSRVGNPT
RHAYETCVAALEEGVGAVACASGVNATATVLELLPKDAHVVVMNGVYGGTFRIMEDYRSR
TSGLTTTYVDLNDIEAVAAAIKPETQLIWIESPTNPLLHLVDIKAVCDLAKAKGILTCID
NTFCSPWNQRPITLGVDLVMHSASKYIGGHSDLTGGVVVAANDALLARLRRISMAIGAVQ
GPFDCYLALRGLKTLDVRMERQCANALQVARFLEGHAQVEQVYYPGLESHPQHELCKRQM
RSGGAVVAMKVKGDRAALNRLVEALQIFVLADSLGGVESMINHSWSMSHCSLSPEQKGVM
GISENLLRLSVGIEDYRDLVEDLDGALKALVAV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory