Comparing PP_4619 FitnessBrowser__Putida:PP_4619 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2v6kA Structure of maleyl pyruvate isomerase, a bacterial glutathione-s- transferase in zeta class, in complex with substrate analogue dicarboxyethyl glutathione (see paper)
52% identity, 99% coverage: 1:207/210 of query aligns to 3:213/214 of 2v6kA
2jl4A Holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class (see paper)
52% identity, 99% coverage: 1:207/210 of query aligns to 1:211/212 of 2jl4A
O86043 Maleylpyruvate isomerase; MPI; Naphthalene degradation protein L; EC 5.2.1.4 from Ralstonia sp. (see paper)
52% identity, 99% coverage: 1:207/210 of query aligns to 1:211/212 of O86043
Q9WVL0 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Mus musculus (Mouse)
45% identity, 99% coverage: 3:210/210 of query aligns to 8:213/216 of Q9WVL0
2cz2A Crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal)
45% identity, 99% coverage: 3:210/210 of query aligns to 5:210/212 of 2cz2A
O43708 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Homo sapiens (Human) (see 10 papers)
43% identity, 99% coverage: 3:210/210 of query aligns to 8:213/216 of O43708
1fw1A Glutathione transferase zeta/maleylacetoacetate isomerase (see paper)
43% identity, 99% coverage: 3:209/210 of query aligns to 4:208/208 of 1fw1A
4kdyA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound gsh in the active site
45% identity, 99% coverage: 1:208/210 of query aligns to 10:215/222 of 4kdyA
4kaeA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound dicarboxyethyl glutathione and citrate in the active site
45% identity, 99% coverage: 1:208/210 of query aligns to 8:213/220 of 4kaeA
3n5oA Crystal structure of putative glutathione transferase from coccidioides immitis bound to glutathione (see paper)
39% identity, 99% coverage: 1:208/210 of query aligns to 4:224/228 of 3n5oA
D2YW48 Probable glutathione S-transferase; EC 2.5.1.18 from Coccidioides immitis (strain RS) (Valley fever fungus)
39% identity, 99% coverage: 1:208/210 of query aligns to 6:226/231 of D2YW48
4pxoA Crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068)
37% identity, 100% coverage: 1:209/210 of query aligns to 3:216/216 of 4pxoA
3qawA Crystal structure of a glutathione-s-transferase from antarctic clam laternula elliptica in a complex with glutathione (see paper)
27% identity, 99% coverage: 4:210/210 of query aligns to 4:214/219 of 3qawA
3uarA Crystal structure of glutathione transferase (target efi-501774) from methylococcus capsulatus str. Bath with gsh bound
31% identity, 97% coverage: 1:203/210 of query aligns to 2:200/203 of 3uarA
1f2eA Structure of sphingomonad, glutathione s-transferase complexed with glutathione
28% identity, 89% coverage: 17:203/210 of query aligns to 16:198/201 of 1f2eA
Sites not aligning to the query:
6m1tA Bacterial beta class sphingomonas chungbukensis glutathione s- transferase
27% identity, 89% coverage: 17:203/210 of query aligns to 16:198/201 of 6m1tA
Sites not aligning to the query:
2gdrA Crystal structure of a bacterial glutathione transferase (see paper)
28% identity, 87% coverage: 1:183/210 of query aligns to 1:178/202 of 2gdrA
2dsaA Ternary complex of bphk, a bacterial gst (see paper)
28% identity, 87% coverage: 1:183/210 of query aligns to 1:178/200 of 2dsaA
4gf0A Crystal structure of glutahtione transferase homolog from sulfitobacter, target efi-501084, with bound glutathione
27% identity, 76% coverage: 24:183/210 of query aligns to 26:186/208 of 4gf0A
Sites not aligning to the query:
3m3mA Crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5]
25% identity, 92% coverage: 2:194/210 of query aligns to 4:194/201 of 3m3mA
>PP_4619 FitnessBrowser__Putida:PP_4619
MELYTYYRSTSSYRVRIALALKGLAYQSLPVNLLQGEQRGEGYVAVNPQGRVPALRTDGG
EVLVQSPAIIEYLEEVYPQPALLPATAEARARVRGVAAIIGCDIHPLHNVSVLNRLRQAG
QDEGQVNQWIGHWISQGLAAVEQLIGDHGFCFGDTPGLADVYLIPQLYAAERFNIDLDSF
PRILRVAALAAAHPAFAKAHPAQQPDSPAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory