Comparing PP_4687 FitnessBrowser__Putida:PP_4687 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
39% identity, 93% coverage: 16:251/255 of query aligns to 26:261/265 of P07821
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
31% identity, 92% coverage: 1:235/255 of query aligns to 2:233/240 of 6mjpA
1l7vC Bacterial abc transporter involved in b12 uptake (see paper)
34% identity, 83% coverage: 27:237/255 of query aligns to 25:231/231 of 1l7vC
5x40A Structure of a cbio dimer bound with amppcp (see paper)
35% identity, 89% coverage: 1:227/255 of query aligns to 4:229/280 of 5x40A
4fi3C Structure of vitamin b12 transporter btucd-f in a nucleotide-bound state (see paper)
33% identity, 84% coverage: 27:239/255 of query aligns to 25:233/248 of 4fi3C
Sites not aligning to the query:
O65934 ABC transporter ATP-binding/permease protein Rv1747; EC 7.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 3 papers)
32% identity, 89% coverage: 2:228/255 of query aligns to 319:542/865 of O65934
Sites not aligning to the query:
Q9AT00 Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic; ABC transporter I family member 13; ABC transporter ABCI.13; AtABCI13; Non-intrinsic ABC protein 11; AtNAP11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 87% coverage: 1:221/255 of query aligns to 84:325/345 of Q9AT00
3d31A Modbc from methanosarcina acetivorans (see paper)
33% identity, 87% coverage: 1:223/255 of query aligns to 1:213/348 of 3d31A
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 89% coverage: 1:227/255 of query aligns to 2:225/241 of 4u00A
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
27% identity, 94% coverage: 1:239/255 of query aligns to 1:238/276 of Q5M243
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
29% identity, 87% coverage: 2:224/255 of query aligns to 4:226/262 of 7chaI
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
29% identity, 87% coverage: 1:223/255 of query aligns to 2:224/253 of 6z5uK
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
29% identity, 87% coverage: 1:223/255 of query aligns to 4:226/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
29% identity, 87% coverage: 1:223/255 of query aligns to 4:226/263 of 7d08B
A0R6H8 Mycobactin import ATP-binding/permease protein IrtA; EC 7.2.2.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
33% identity, 84% coverage: 16:229/255 of query aligns to 624:833/860 of A0R6H8
Sites not aligning to the query:
7mdyC Lolcde nucleotide-bound
33% identity, 80% coverage: 15:218/255 of query aligns to 20:222/226 of 7mdyC
Sites not aligning to the query:
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
33% identity, 80% coverage: 15:218/255 of query aligns to 23:225/233 of P75957
7arlD Lolcde in complex with lipoprotein and adp (see paper)
33% identity, 80% coverage: 15:218/255 of query aligns to 20:222/222 of 7arlD
7ehlA Cryo-em structure of human abcb8 transporter in nucleotide binding state (see paper)
33% identity, 89% coverage: 8:233/255 of query aligns to 334:556/563 of 7ehlA
Sites not aligning to the query:
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
30% identity, 86% coverage: 16:235/255 of query aligns to 17:233/234 of 6b89A
Sites not aligning to the query:
>PP_4687 FitnessBrowser__Putida:PP_4687
MLQVEGLYLCRGSNEVLHDIHLQLPPGQVVGVLGPNGAGKSSLLSVLCGELAPDRGRVTL
QGRPLADWAGQERARRLAVLPQVSSLGFSFRVEEVVGMGRMPHGTGQRRDAEIVEAALRA
ADAWHLVARSYLALSGGERQRVHLARVLAQLWPGEEGSTLLLDEPTSMLDPLHQHTTLEA
VRRFADCGAAVLVILHDLNLAARYCDRILLLEQGRCHAFATPEAALTPAALKAVYGIDVL
VQAHPERGHPLIITR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory