SitesBLAST – Find functional sites

 

SitesBLAST

Comparing PP_4749 FitnessBrowser__Putida:PP_4749 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 2 hits to proteins with known functional sites (download)

4ymtC Crystal structure of an amino acid abc transporter complex with arginines (see paper)
31% identity, 97% coverage: 3:214/219 of query aligns to 4:214/215 of 4ymtC

query
sites
4ymtC
E
 
D
L
 
F
L
 
L
T
 
S
M
 
M
W
 
-
M
 
V
Q
 
K
W
 
Y
L
 
T
P
 
P
E
 
L
L
 
F
W
 
I
K
 
S
G
 
G
F
 
L
V
 
I
L
 
M
S
 
T
M
 
L
Q
 
K
V
 
L
T
 
T
A
 
F
V
 
L
S
 
A
L
 
V
G
 
T
L
 
I
G
 
G
V
 
V
V
 
L
L
 
M
G
 
G
L
 
L
L
 
F
L
 
I
A
 
A
L
 
L
G
 
M
V
 
K
S
 
M
S
 
S
P
 
S
S
 
I
R
 
K
W
 
P
L
 
I
R
 
K
Y
 
L
P
 
V
S
 
A
L
 
S
V
 
S
V
 
Y
V
 
I
E
 
E
L
 
V
G
 
I
R
 
R
G
 
G
A
x
T
P
|
P
A
x
L
L
 
L
I
 
V
L
 
Q
L
 
L
Q
 
L
Y
 
L
F
 
I
Y
 
Y
F
 
N
G
 
G
L
 
L
P
 
M
S
 
Q
V
 
F
N
 
G
L
 
M
T
 
N
L
 
I
T
 
P
S
 
A
F
 
F
W
 
T
A
 
A
A
 
G
A
 
V
L
 
S
A
 
A
M
 
L
A
 
A
Y
 
I
C
x
N
T
x
S
A
 
S
A
 
A
Y
|
Y
T
 
V
S
 
A
E
 
E
I
 
I
I
 
I
R
 
R
G
 
A
G
 
G
I
 
I
E
 
Q
S
 
A
V
 
V
A
 
D
A
 
P
G
 
G
Q
 
Q
T
 
N
E
 
E
A
 
A
A
 
A
E
 
R
V
 
S
I
 
L
G
 
G
L
 
M
N
 
T
R
 
H
F
 
A
D
 
M
A
 
A
L
 
M
R
 
R
F
 
Y
V
 
V
I
 
I
L
 
I
P
 
P
Q
 
Q
A
 
A
L
 
I
R
 
K
V
 
N
A
 
I
L
 
L
P
 
P
S
 
A
L
 
L
L
 
G
G
 
N
F
x
E
S
 
F
I
 
I
M
 
V
M
|
M
F
 
L
Q
x
K
A
x
E
S
 
S
S
 
A
L
 
I
C
 
V
F
 
S
T
 
V
I
 
I
A
 
G
L
 
F
P
 
A
E
 
D
I
 
L
V
 
T
S
 
R
R
 
Q
A
 
A
S
 
D
S
 
I
I
 
I
G
 
Q
S
 
S
S
 
V
T
 
T
F
 
Y
E
 
R
Y
 
Y
M
 
F
-
 
E
P
 
P
V
 
Y
L
 
I
I
 
I
L
 
I
A
 
A
G
 
A
L
 
I
M
 
Y
Y
 
F
A
 
V
A
 
M
V
 
T
C
 
L
A
 
T
P
 
F
A
 
S
T
 
K
L
 
L
G
 
-
V
 
L
A
 
S
A
 
L
L
 
F
E
 
E
K
 
R
R
 
R
L
 
L

4ymwC Crystal structure of an amino acid abc transporter with histidines (see paper)
31% identity, 97% coverage: 3:214/219 of query aligns to 4:214/214 of 4ymwC

query
sites
4ymwC
E
 
D
L
 
F
L
 
L
T
 
S
M
 
M
W
 
-
M
 
V
Q
 
K
W
 
Y
L
 
T
P
 
P
E
 
L
L
 
F
W
 
I
K
 
S
G
 
G
F
 
L
V
 
I
L
 
M
S
 
T
M
 
L
Q
 
K
V
 
L
T
 
T
A
 
F
V
 
L
S
 
A
L
 
V
G
 
T
L
 
I
G
 
G
V
 
V
V
 
L
L
 
M
G
 
G
L
 
L
L
 
F
L
 
I
A
 
A
L
 
L
G
 
M
V
 
K
S
 
M
S
 
S
P
 
S
S
 
I
R
 
K
W
 
P
L
 
I
R
 
K
Y
 
L
P
 
V
S
 
A
L
 
S
V
 
S
V
 
Y
V
 
I
E
 
E
L
 
V
G
 
I
R
 
R
G
 
G
A
 
T
P
 
P
A
x
L
L
 
L
I
 
V
L
 
Q
L
 
L
Q
 
L
Y
 
L
F
 
I
Y
 
Y
F
 
N
G
 
G
L
 
L
P
 
M
S
 
Q
V
 
F
N
 
G
L
 
M
T
 
N
L
 
I
T
 
P
S
 
A
F
 
F
W
 
T
A
 
A
A
 
G
A
 
V
L
 
S
A
 
A
M
 
L
A
 
A
Y
 
I
C
x
N
T
 
S
A
 
S
A
 
A
Y
|
Y
T
 
V
S
 
A
E
 
E
I
 
I
I
 
I
R
 
R
G
 
A
G
 
G
I
 
I
E
 
Q
S
 
A
V
 
V
A
 
D
A
 
P
G
 
G
Q
 
Q
T
 
N
E
 
E
A
 
A
A
 
A
E
 
R
V
 
S
I
 
L
G
 
G
L
 
M
N
 
T
R
 
H
F
 
A
D
 
M
A
 
A
L
 
M
R
 
R
F
 
Y
V
 
V
I
 
I
L
 
I
P
 
P
Q
 
Q
A
 
A
L
 
I
R
 
K
V
 
N
A
 
I
L
 
L
P
 
P
S
 
A
L
 
L
L
 
G
G
 
N
F
x
E
S
 
F
I
 
I
M
 
V
M
|
M
F
 
L
Q
 
K
A
x
E
S
 
S
S
 
A
L
 
I
C
 
V
F
 
S
T
 
V
I
 
I
A
 
G
L
 
F
P
 
A
E
 
D
I
 
L
V
 
T
S
 
R
R
 
Q
A
 
A
S
 
D
S
 
I
I
 
I
G
 
Q
S
 
S
S
 
V
T
 
T
F
 
Y
E
 
R
Y
 
Y
M
 
F
-
 
E
P
 
P
V
 
Y
L
 
I
I
 
I
L
 
I
A
 
A
G
 
A
L
 
I
M
 
Y
Y
 
F
A
 
V
A
 
M
V
 
T
C
 
L
A
 
T
P
 
F
A
 
S
T
 
K
L
 
L
G
 
-
V
 
L
A
 
S
A
 
L
L
 
F
E
 
E
K
 
R
R
 
R
L
 
L

Query Sequence

>PP_4749 FitnessBrowser__Putida:PP_4749
MSELLTMWMQWLPELWKGFVLSMQVTAVSLGLGVVLGLLLALGVSSPSRWLRYPSLVVVE
LGRGAPALILLQYFYFGLPSVNLTLTSFWAAALAMAYCTAAYTSEIIRGGIESVAAGQTE
AAEVIGLNRFDALRFVILPQALRVALPSLLGFSIMMFQASSLCFTIALPEIVSRASSIGS
STFEYMPVLILAGLMYAAVCAPATLGVAALEKRLAPSQP

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory