Comparing PP_4871 FitnessBrowser__Putida:PP_4871 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
P48636 Cytokinin riboside 5'-monophosphate phosphoribohydrolase; AMP nucleosidase; PaLOG; EC 3.2.2.n1; EC 3.2.2.4 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
77% identity, 100% coverage: 1:195/195 of query aligns to 1:195/195 of P48636
5zbkA Crystal structure of type-i log from pseudomonas aeruginosa pao1 in complex with amp (see paper)
78% identity, 92% coverage: 3:182/195 of query aligns to 2:181/182 of 5zbkA
Q5ZC82 Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG; Protein LONELY GUY; EC 3.2.2.n1 from Oryza sativa subsp. japonica (Rice) (see paper)
47% identity, 98% coverage: 4:194/195 of query aligns to 36:228/242 of Q5ZC82
5zblD Crystal structure of type-i log from corynebacterium glutamicum in complex with amp (see paper)
49% identity, 92% coverage: 3:182/195 of query aligns to 2:180/181 of 5zblD
5ajuA Crystal structure of ligand-free phosphoribohydroxylase lonely guy from claviceps purpurea in complex with phosphoribose (see paper)
41% identity, 85% coverage: 2:166/195 of query aligns to 1:188/217 of 5ajuA
O05306 Cytokinin riboside 5'-monophosphate phosphoribohydrolase; Protein LONELY GUY homolog; LOG homolog; EC 3.2.2.n1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
45% identity, 84% coverage: 5:167/195 of query aligns to 12:173/187 of O05306
7w2iA Crystal structure of log (rv1205) from mycobacterium tuberculosis (see paper)
45% identity, 84% coverage: 5:167/195 of query aligns to 8:169/183 of 7w2iA
3sbxA Crystal structure of a putative uncharacterized protein from mycobacterium marinum bound to adenosine 5'-monophosphate amp (see paper)
42% identity, 89% coverage: 5:177/195 of query aligns to 3:174/177 of 3sbxA
>PP_4871 FitnessBrowser__Putida:PP_4871
MPVRSVCVFCGASMGANPAYREAAVALGQAIARRGLTLVYGGGAVGLMGVVADAAMAAGG
EVVGIIPQSLLDAEVGHKGLTRLEVVDGMHARKARMAELSDAFIALPGGLGTLEELFEVW
TWGQLGYHAKPLGLLDVNGFYDKLGGFLDHIVEEGFVRPQHRAMLLLGQQPDELLEGMDS
FVAPVAPKWVDKQPD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory