SitesBLAST
Comparing PP_5154 FitnessBrowser__Putida:PP_5154 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
38% identity, 97% coverage: 10:451/455 of query aligns to 20:464/465 of 3pm9A
- active site: A149 (= A139), L159 (≠ M149)
- binding flavin-adenine dinucleotide: P69 (= P59), Q70 (≠ S60), G71 (= G61), G72 (= G62), N73 (≠ R63), T74 (= T64), G75 (= G65), L76 (= L66), G79 (= G69), Q80 (≠ A70), L91 (≠ F81), L133 (≠ F123), G134 (≠ A124), A135 (≠ S125), C139 (≠ S129), T140 (≠ Q130), G142 (= G132), G143 (= G133), S146 (≠ G136), T147 (= T137), A149 (= A139), G150 (= G140), E200 (= E190), G201 (= G191), I205 (≠ F195), I206 (≠ V196), E423 (= E410)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
38% identity, 98% coverage: 6:452/455 of query aligns to 22:464/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R315), T337 (≠ S319), K348 (= K329), Y379 (= Y362), H381 (= H364), H388 (= H371), H423 (= H411)
- binding flavin-adenine dinucleotide: W39 (= W23), P75 (= P59), Q76 (≠ S60), G77 (= G61), G78 (= G62), N79 (≠ R63), T80 (= T64), G81 (= G65), M82 (≠ L66), G85 (= G69), S86 (≠ A70), L139 (≠ F123), G140 (≠ A124), A141 (≠ S125), C145 (≠ S129), G149 (= G133), N150 (= N134), A152 (≠ G136), T153 (= T137), G157 (= G141), G207 (= G191), I212 (≠ V196), E422 (= E410), N459 (= N447)
- binding zinc ion: H381 (= H364), H388 (= H371), E422 (= E410)
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
38% identity, 98% coverage: 6:452/455 of query aligns to 22:464/466 of 6lpuA
- binding flavin-adenine dinucleotide: W39 (= W23), P75 (= P59), G77 (= G61), G78 (= G62), N79 (≠ R63), T80 (= T64), G81 (= G65), G85 (= G69), S86 (≠ A70), L139 (≠ F123), G140 (≠ A124), A141 (≠ S125), C145 (≠ S129), H146 (≠ Q130), G148 (= G132), G149 (= G133), N150 (= N134), A152 (≠ G136), T153 (= T137), A155 (= A139), E206 (= E190), G207 (= G191), I211 (≠ F195), I212 (≠ V196), E422 (= E410), N459 (= N447)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R315), T337 (≠ S319), K348 (= K329), Y379 (= Y362), H381 (= H364), H388 (= H371), H423 (= H411)
- binding zinc ion: H381 (= H364), H388 (= H371), E422 (= E410)
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
38% identity, 98% coverage: 6:452/455 of query aligns to 22:464/466 of 6lpqA
- binding flavin-adenine dinucleotide: W39 (= W23), P75 (= P59), G77 (= G61), G78 (= G62), N79 (≠ R63), T80 (= T64), G81 (= G65), G85 (= G69), S86 (≠ A70), L139 (≠ F123), G140 (≠ A124), A141 (≠ S125), C145 (≠ S129), H146 (≠ Q130), G149 (= G133), N150 (= N134), A152 (≠ G136), T153 (= T137), A155 (= A139), G157 (= G141), E206 (= E190), G207 (= G191), I211 (≠ F195), I212 (≠ V196), E422 (= E410), N459 (= N447)
- binding d-malate: M82 (≠ L66), R333 (= R315), T337 (≠ S319), K348 (= K329), Y379 (= Y362), H381 (= H364), H388 (= H371), E422 (= E410), H423 (= H411)
- binding zinc ion: H381 (= H364), H388 (= H371), E422 (= E410)
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
38% identity, 98% coverage: 6:452/455 of query aligns to 22:464/466 of 6lppA
- binding (2R)-2-hydroxypentanedioic acid: R333 (= R315), T337 (≠ S319), K348 (= K329), Y379 (= Y362), H381 (= H364), H388 (= H371), N390 (= N373), H423 (= H411)
- binding flavin-adenine dinucleotide: W39 (= W23), P75 (= P59), G77 (= G61), G78 (= G62), N79 (≠ R63), T80 (= T64), G81 (= G65), M82 (≠ L66), G85 (= G69), S86 (≠ A70), L139 (≠ F123), G140 (≠ A124), A141 (≠ S125), C145 (≠ S129), G149 (= G133), N150 (= N134), A152 (≠ G136), T153 (= T137), A155 (= A139), G157 (= G141), G207 (= G191), I212 (≠ V196), E422 (= E410), H423 (= H411)
- binding zinc ion: H381 (= H364), H388 (= H371), E422 (= E410)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
38% identity, 98% coverage: 6:452/455 of query aligns to 23:465/467 of 6lpnB
- binding flavin-adenine dinucleotide: W40 (= W23), P76 (= P59), G78 (= G61), G79 (= G62), N80 (≠ R63), T81 (= T64), G82 (= G65), M83 (≠ L66), G86 (= G69), S87 (≠ A70), L140 (≠ F123), A142 (≠ S125), C146 (≠ S129), H147 (≠ Q130), G150 (= G133), N151 (= N134), A153 (≠ G136), T154 (= T137), G208 (= G191), I212 (≠ F195), I213 (≠ V196), E423 (= E410), N460 (= N447)
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
38% identity, 98% coverage: 6:452/455 of query aligns to 75:517/521 of Q8N465
- S109 (≠ I40) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ V58) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G62) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ V78) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (= M84) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ V103) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (= P120) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (≠ G136) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ G162) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G164) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (≠ S304) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R315) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ S319) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ P327) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (= K329) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ D347) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (≠ D356) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H364) binding ; mutation to A: Loss of catalytic activity.
- G436 (= G366) to V: slight reduction in catalytic activity
- N439 (= N369) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H371) binding ; mutation to A: Loss of catalytic activity.
- N443 (= N373) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (≠ I374) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (≠ K382) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E410) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H411) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G412) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
34% identity, 96% coverage: 13:450/455 of query aligns to 50:494/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
31% identity, 93% coverage: 31:451/455 of query aligns to 45:463/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P59), G75 (= G61), S76 (≠ G62), G77 (≠ R63), T78 (= T64), G79 (= G65), L80 (= L66), A83 (≠ G69), C84 (≠ A70), P137 (≠ A124), G138 (≠ S125), E139 (≠ S126), A142 (≠ S129), T143 (≠ Q130), G146 (= G133), N147 (= N134), S149 (≠ G136), T150 (= T137), A152 (= A139), G153 (= G140), E203 (= E190), G204 (= G191), I209 (≠ V196), E422 (= E410), H423 (= H411)
- binding fe (iii) ion: H377 (= H364), H384 (= H371), E422 (= E410)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 99% coverage: 3:452/455 of query aligns to 11:456/459 of P9WIT1
- K354 (≠ A341) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
29% identity, 96% coverage: 17:452/455 of query aligns to 26:454/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R315), W322 (vs. gap), H369 (= H364), H376 (= H371), H413 (= H411)
- binding flavin-adenine dinucleotide: E32 (≠ W23), P68 (= P59), G70 (= G61), T71 (≠ G62), G72 (≠ R63), T73 (= T64), G74 (= G65), G78 (= G69), V79 (≠ A70), L90 (≠ F81), P132 (≠ F123), G133 (≠ A124), A134 (≠ S125), G140 (= G133), M141 (≠ N134), A143 (≠ G136), T144 (= T137), A146 (= A139), S147 (≠ G140), E200 (= E190), G201 (= G191), I206 (≠ V196), W322 (vs. gap), E412 (= E410), H413 (= H411), N449 (= N447)
- binding manganese (ii) ion: H369 (= H364), H376 (= H371), E412 (= E410)
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
29% identity, 96% coverage: 17:452/455 of query aligns to 26:454/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R315), W322 (vs. gap), S336 (≠ K329), H369 (= H364), H376 (= H371), H413 (= H411)
- binding flavin-adenine dinucleotide: P68 (= P59), G70 (= G61), T71 (≠ G62), G72 (≠ R63), T73 (= T64), G74 (= G65), G78 (= G69), V79 (≠ A70), L90 (≠ F81), P132 (≠ F123), G133 (≠ A124), A134 (≠ S125), G140 (= G133), M141 (≠ N134), A143 (≠ G136), T144 (= T137), A146 (= A139), S147 (≠ G140), E200 (= E190), G201 (= G191), I206 (≠ V196), E412 (= E410), N449 (= N447)
- binding manganese (ii) ion: H369 (= H364), H376 (= H371), E412 (= E410)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
29% identity, 96% coverage: 17:452/455 of query aligns to 26:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R315), W322 (vs. gap), H369 (= H364), H376 (= H371), H414 (= H411)
- binding flavin-adenine dinucleotide: P68 (= P59), G70 (= G61), T71 (≠ G62), G72 (≠ R63), T73 (= T64), G74 (= G65), G78 (= G69), V79 (≠ A70), L90 (≠ F81), P132 (≠ F123), G133 (≠ A124), A134 (≠ S125), G140 (= G133), M141 (≠ N134), A143 (≠ G136), T144 (= T137), A146 (= A139), S147 (≠ G140), E200 (= E190), G201 (= G191), I206 (≠ V196), W322 (vs. gap), E413 (= E410), N450 (= N447)
- binding manganese (ii) ion: H369 (= H364), H376 (= H371), E413 (= E410)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
29% identity, 96% coverage: 17:452/455 of query aligns to 26:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L66), R317 (= R315), W321 (vs. gap), H368 (= H364), H375 (= H371), H413 (= H411)
- binding flavin-adenine dinucleotide: P68 (= P59), G70 (= G61), T71 (≠ G62), G72 (≠ R63), T73 (= T64), G74 (= G65), G78 (= G69), V79 (≠ A70), L90 (≠ F81), P132 (≠ F123), G133 (≠ A124), A134 (≠ S125), G140 (= G133), M141 (≠ N134), A143 (≠ G136), T144 (= T137), A146 (= A139), S147 (≠ G140), E200 (= E190), G201 (= G191), I206 (≠ V196), W321 (vs. gap), Y322 (= Y317), E412 (= E410), H413 (= H411), N449 (= N447)
- binding manganese (ii) ion: H368 (= H364), H375 (= H371), E412 (= E410)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
29% identity, 96% coverage: 17:452/455 of query aligns to 26:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: E32 (≠ W23), P68 (= P59), G70 (= G61), T71 (≠ G62), G72 (≠ R63), T73 (= T64), G74 (= G65), G78 (= G69), V79 (≠ A70), L90 (≠ F81), P132 (≠ F123), G133 (≠ A124), A134 (≠ S125), G140 (= G133), M141 (≠ N134), A143 (≠ G136), T144 (= T137), A146 (= A139), S147 (≠ G140), E200 (= E190), G201 (= G191), I206 (≠ V196), W322 (vs. gap), E413 (= E410), H414 (= H411), N450 (= N447)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R315), H369 (= H364), H376 (= H371), H414 (= H411)
- binding manganese (ii) ion: H369 (= H364), H376 (= H371), E413 (= E410)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
29% identity, 96% coverage: 17:452/455 of query aligns to 26:455/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (= P59), G70 (= G61), T71 (≠ G62), G72 (≠ R63), T73 (= T64), G74 (= G65), G78 (= G69), V79 (≠ A70), L90 (≠ F81), P132 (≠ F123), G133 (≠ A124), A134 (≠ S125), G140 (= G133), M141 (≠ N134), A143 (≠ G136), T144 (= T137), A146 (= A139), S147 (≠ G140), E200 (= E190), G201 (= G191), I206 (≠ V196), H369 (= H364), E413 (= E410), N450 (= N447)
- binding deaminohydroxyvaline: R319 (= R315), H414 (= H411)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
29% identity, 96% coverage: 17:452/455 of query aligns to 26:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (≠ W23), P68 (= P59), G70 (= G61), T71 (≠ G62), G72 (≠ R63), T73 (= T64), G74 (= G65), G78 (= G69), V79 (≠ A70), L90 (≠ F81), P132 (≠ F123), G133 (≠ A124), A134 (≠ S125), G140 (= G133), M141 (≠ N134), A143 (≠ G136), T144 (= T137), A146 (= A139), S147 (≠ G140), E200 (= E190), G201 (= G191), I206 (≠ V196), W323 (vs. gap), E414 (= E410), H415 (= H411), N451 (= N447)
- binding manganese (ii) ion: H370 (= H364), H377 (= H371), E414 (= E410)
- binding pyruvic acid: R319 (= R315), H370 (= H364), H377 (= H371), H415 (= H411)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
29% identity, 96% coverage: 17:452/455 of query aligns to 26:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P59), G70 (= G61), T71 (≠ G62), G72 (≠ R63), T73 (= T64), G74 (= G65), G78 (= G69), V79 (≠ A70), L90 (≠ F81), P132 (≠ F123), G133 (≠ A124), A134 (≠ S125), G140 (= G133), M141 (≠ N134), A143 (≠ G136), T144 (= T137), A146 (= A139), S147 (≠ G140), E200 (= E190), G201 (= G191), I206 (≠ V196), W322 (vs. gap), E413 (= E410), H414 (= H411), N450 (= N447)
- binding lactic acid: R318 (= R315), H369 (= H364), H376 (= H371), H414 (= H411)
- binding manganese (ii) ion: H369 (= H364), H376 (= H371), E413 (= E410)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
29% identity, 96% coverage: 17:452/455 of query aligns to 26:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R315), H369 (= H364), H376 (= H371), H414 (= H411)
- binding flavin-adenine dinucleotide: P68 (= P59), G70 (= G61), T71 (≠ G62), G72 (≠ R63), T73 (= T64), G74 (= G65), G78 (= G69), V79 (≠ A70), L90 (≠ F81), P132 (≠ F123), G133 (≠ A124), A134 (≠ S125), G140 (= G133), M141 (≠ N134), A143 (≠ G136), T144 (= T137), A146 (= A139), S147 (≠ G140), E200 (= E190), G201 (= G191), I206 (≠ V196), W322 (vs. gap), E413 (= E410), H414 (= H411), N450 (= N447)
- binding manganese (ii) ion: H369 (= H364), H376 (= H371), E413 (= E410)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
29% identity, 96% coverage: 17:452/455 of query aligns to 26:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P59), G70 (= G61), T71 (≠ G62), G72 (≠ R63), T73 (= T64), G74 (= G65), G78 (= G69), V79 (≠ A70), L90 (≠ F81), P132 (≠ F123), G133 (≠ A124), A134 (≠ S125), G140 (= G133), M141 (≠ N134), A143 (≠ G136), T144 (= T137), A146 (= A139), S147 (≠ G140), E200 (= E190), G201 (= G191), I206 (≠ V196), Y324 (= Y317), H370 (= H364), E414 (= E410), N451 (= N447)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R315), W323 (vs. gap), H415 (= H411)
Query Sequence
>PP_5154 FitnessBrowser__Putida:PP_5154
MTLVDPGKVLTDPVSLEAYGKDWTKHYPPAPSAIVFPKTIEQVQAIVHWANAHKVALVPS
GGRTGLSAGAVAANGEVVVAFDYMNQILGFNAFDRTVVCQPGVVTRQLQTYAEEQGLYYP
VDFASSGSSQIGGNIGTNAGGIKVIRYGMTRNWVAGLKVVTGKGELLELNKDLIKNATGY
DLRQLFIGAEGTLGFVVEATMRLDRAPRNLTAMVLGTPDFDSIMPVLHAFQGKLDLTAFE
FFSDKGLAKILARGDVPAPFATDCPFYALLEFEASTEDVANEALATFEHCVEQGWVLDGV
MSQSESQLKNLWKLREYLSETISHWTPYKNDISVTVSKVPAFLRDIDAIVSEHYPDYEVV
WYGHIGDGNLHLNILKPEHMSKDDFFASCAKVNKWVFEIVERYNGSISAEHGVGMTKRDY
LGYSRSPEEIACMKAIKAVFDPNGIMNPGKIFAPE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory