Comparing PP_5163 FitnessBrowser__Putida:PP_5163 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
54% identity, 95% coverage: 4:181/188 of query aligns to 4:182/188 of 3igjC
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
49% identity, 96% coverage: 2:181/188 of query aligns to 1:180/186 of 4isxA
Sites not aligning to the query:
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
41% identity, 96% coverage: 1:181/188 of query aligns to 1:181/203 of P07464
Sites not aligning to the query:
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
41% identity, 96% coverage: 1:181/188 of query aligns to 2:180/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
41% identity, 96% coverage: 1:181/188 of query aligns to 2:180/201 of 1kruA
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
41% identity, 96% coverage: 1:181/188 of query aligns to 2:180/200 of 1krrA
Sites not aligning to the query:
3nz2J Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
40% identity, 96% coverage: 1:181/188 of query aligns to 2:180/185 of 3nz2J
Sites not aligning to the query:
3nz2C Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
40% identity, 95% coverage: 3:181/188 of query aligns to 1:177/183 of 3nz2C
Sites not aligning to the query:
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
39% identity, 95% coverage: 3:181/188 of query aligns to 1:180/190 of 5u2kA
3ectA Crystal structure of the hexapeptide-repeat containing- acetyltransferase vca0836 from vibrio cholerae
41% identity, 93% coverage: 8:181/188 of query aligns to 3:170/176 of 3ectA
A1ADJ6 Polysialic acid O-acetyltransferase; Capsule O-acetyl transferase; EC 2.3.1.136 from Escherichia coli O1:K1 / APEC (see paper)
29% identity, 68% coverage: 54:181/188 of query aligns to 147:276/307 of A1ADJ6
4mzuF Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
34% identity, 69% coverage: 52:181/188 of query aligns to 19:140/294 of 4mzuF
Sites not aligning to the query:
4mzuB Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
34% identity, 69% coverage: 52:181/188 of query aligns to 19:139/290 of 4mzuB
Sites not aligning to the query:
P50870 Streptogramin A acetyltransferase; Virginiamycin acetyltransferase D; Vat(D); EC 2.3.1.- from Enterococcus faecium (Streptococcus faecium) (see paper)
35% identity, 56% coverage: 75:179/188 of query aligns to 29:161/209 of P50870
3dhoA Structure of streptogramin acetyltransferase in complex with an inhibitor
39% identity, 45% coverage: 96:179/188 of query aligns to 61:161/203 of 3dhoA
Sites not aligning to the query:
1mrlA Crystal structure of streptogramin a acetyltransferase with dalfopristin (see paper)
35% identity, 56% coverage: 75:179/188 of query aligns to 29:161/204 of 1mrlA
1khrA Crystal structure of vat(d) in complex with virginiamycin and coenzyme a (see paper)
39% identity, 45% coverage: 96:179/188 of query aligns to 61:161/206 of 1khrA
Sites not aligning to the query:
1kk4A Crystal structure of vat(d) in complex with acetyl-coa (see paper)
39% identity, 45% coverage: 96:179/188 of query aligns to 61:161/205 of 1kk4A
Sites not aligning to the query:
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
47% identity, 46% coverage: 96:181/188 of query aligns to 154:232/233 of 4n6bA
Sites not aligning to the query:
8vr6A Crystal structure of the pcryo_0619 n-acetryltransferase from psychrobacter cryohalolentis k5 in the presence of coa-disulfide
37% identity, 55% coverage: 76:179/188 of query aligns to 61:165/177 of 8vr6A
>PP_5163 FitnessBrowser__Putida:PP_5163
MSLSEKHKMLTGQLYHAGCPELQAEQIANKHWMHRYNNSVELLNDARHGLLVEHFGQVGE
GAVIRPPFYCDYGYNISVGRNTFMNFNCVILDVVPVRIGEDCQIGPNVQIYTADHPLDPE
VRRSGLESGRPVTIGDNVWIGGAAIILPGVTIGDNAIVGAGSVVTRDVPAGATVVGNPAR
VRQPDQGQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory