Comparing PP_5231 FitnessBrowser__Putida:PP_5231 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
3vayA Crystal structure of 2-haloacid dehalogenase from pseudomonas syringae pv. Tomato dc3000 (see paper)
75% identity, 99% coverage: 3:230/231 of query aligns to 2:229/230 of 3vayA
4ygrA Crystal structure of had phosphatase from thermococcus onnurineus (see paper)
36% identity, 55% coverage: 103:228/231 of query aligns to 83:211/215 of 4ygrA
Sites not aligning to the query:
6z1kA A de novo enzyme for the morita-baylis-hillman reaction bh32.6 (see paper)
30% identity, 58% coverage: 71:205/231 of query aligns to 62:204/231 of 6z1kA
Sites not aligning to the query:
6q7nA Crystal structure of bh32 alkylated with the mechanistic inhibitor 2- bromoacetophenone (see paper)
29% identity, 58% coverage: 71:205/231 of query aligns to 62:204/230 of 6q7nA
Sites not aligning to the query:
4ffdA Crystal structure of engineered protein. Northeast structural genomics consortium target or48
29% identity, 58% coverage: 71:205/231 of query aligns to 62:204/230 of 4ffdA
Sites not aligning to the query:
3qnmA Haloalkane dehalogenase family member from bacteroides thetaiotaomicron of unknown function
25% identity, 98% coverage: 1:227/231 of query aligns to 1:230/231 of 3qnmA
3i76B The crystal structure of the orthorhombic form of the putative had- hydrolase yfnb from bacillus subtilis bound to magnesium reveals interdomain movement
30% identity, 97% coverage: 4:227/231 of query aligns to 4:226/229 of 3i76B
2no5B Crystal structure analysis of a dehalogenase with intermediate complex (see paper)
27% identity, 57% coverage: 98:229/231 of query aligns to 88:225/226 of 2no5B
Sites not aligning to the query:
Q51645 (S)-2-haloacid dehalogenase 4A; 2-haloalkanoic acid dehalogenase IVA; Halocarboxylic acid halidohydrolase IVA; L-2-haloacid dehalogenase IVA; EC 3.8.1.2 from Burkholderia cepacia (Pseudomonas cepacia) (see 2 papers)
27% identity, 57% coverage: 98:229/231 of query aligns to 88:225/231 of Q51645
Sites not aligning to the query:
4g9bA Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid
26% identity, 91% coverage: 1:211/231 of query aligns to 2:199/227 of 4g9bA
>PP_5231 FitnessBrowser__Putida:PP_5231
MSIKLITFDLDDTLWDTAPVIATAEVVLRDWLEANAPTLGSVPVEHLFAIRERLVQAEPG
LKHRISALRRRVLFHALEEVGYSEQHAQALANEGFEVFLHARHQVEIFPEVQPVLEILRH
QYILGVVTNGNADVSRLGLADYFRFALCAEDLGIGKPDPAPFLEALRRGEVDAGAAVHIG
DHPGDDIAGAQRAGLRAVWFNPQGKAWTGDQAPDAEIQRLSQLPDVLARWR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory