Comparing PP_5298 FitnessBrowser__Putida:PP_5298 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
7d50B Spua mutant - h221n with glutamyl-thioester (see paper)
56% identity, 97% coverage: 2:249/255 of query aligns to 5:254/255 of 7d50B
7d53A Spua mutant - h221n with glu (see paper)
57% identity, 96% coverage: 6:249/255 of query aligns to 3:248/249 of 7d53A
7d4rB Spua native structure (see paper)
50% identity, 95% coverage: 6:247/255 of query aligns to 1:214/215 of 7d4rB
P76038 Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD; Gamma-Glu-GABA hydrolase; EC 3.5.1.94 from Escherichia coli (strain K12) (see paper)
47% identity, 96% coverage: 7:250/255 of query aligns to 8:251/254 of P76038
6vtvB Crystal structure of puud gamma-glutamyl-gamma-aminobutyrate hydrolase from e. Coli
47% identity, 96% coverage: 7:250/255 of query aligns to 6:249/252 of 6vtvB
3fijA Crystal structure of a uncharacterized protein lin1909
38% identity, 83% coverage: 29:239/255 of query aligns to 12:216/224 of 3fijA
O33341 Putative glutamine amidotransferase Rv2859c; EC 2.4.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 96% coverage: 7:250/255 of query aligns to 66:302/308 of O33341
>PP_5298 FitnessBrowser__Putida:PP_5298
MSANAVPLIGVSACRQQVGKNSSHTVGDKYVEAAGFAGLPLILPARDGGSDTQALLARLH
GIVFTGSPSNIEPHHYNGAPSVAGTRHDLARDRLTLPLLQAAIAVGVPVFCICRGYQELN
VALGGSLHQRVQELPGYLDHREPEDAPLEVQYGPRHSVSIEPGGLFERLGLVAQFEVNSL
HSQGIDRLAPGLRVEARAPDGLIEAVSMPAAPGFVLGVQWHPEWRFNENPVSLRLFQAFR
EACNAYAAREGLRQE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory