Comparing Pf1N1B4_1024 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1024 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
5ti1H Crystal structure of fumarylacetoacetate hydrolase from burkholderia xenovorans lb400
52% identity, 98% coverage: 8:433/434 of query aligns to 14:428/430 of 5ti1H
P16930 Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 from Homo sapiens (Human) (see 14 papers)
49% identity, 96% coverage: 18:433/434 of query aligns to 10:415/419 of P16930
Sites not aligning to the query:
1hyoB Crystal structure of fumarylacetoacetate hydrolase complexed with 4- (hydroxymethylphosphinoyl)-3-oxo-butanoic acid (see paper)
48% identity, 96% coverage: 18:433/434 of query aligns to 12:417/419 of 1hyoB
P35505 Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 from Mus musculus (Mouse) (see 3 papers)
48% identity, 96% coverage: 18:433/434 of query aligns to 10:415/419 of P35505
2hzyA Mouse fumarylacetoacetate hydrolase complexes with a transition-state mimic of the complete substrate (see paper)
48% identity, 96% coverage: 18:433/434 of query aligns to 10:415/416 of 2hzyA
1qcoA Crystal structure of fumarylacetoacetate hydrolase complexed with fumarate and acetoacetate (see paper)
48% identity, 96% coverage: 18:433/434 of query aligns to 10:415/416 of 1qcoA
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
27% identity, 40% coverage: 200:374/434 of query aligns to 143:274/303 of 8sutA
Sites not aligning to the query:
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
27% identity, 40% coverage: 200:374/434 of query aligns to 142:273/303 of 8skyB
Sites not aligning to the query:
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
26% identity, 40% coverage: 204:375/434 of query aligns to 122:251/290 of 8gstC
Sites not aligning to the query:
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
26% identity, 40% coverage: 204:375/434 of query aligns to 122:251/290 of 8gsrA
>Pf1N1B4_1024 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1024
MTQTSITRSWVASANGHADFPLQNLPLGVFSVKGSAPRSGVAIGDHIFDLEAALDAGLFD
GVAKKAVEATRGGQLNAFFELGREARVALRERLIELFKEGSTLHGKIEAQGAKLLPLAAD
CEMHLPAKINDYTDFYVGIEHAQNVGKLFRPDNPLLPNYKYVPIGYHGRASTIRPSGTDV
RRPKGQTLPAGQTEPTFGPCARLDYELELGIWIGQGNAMGDSIAIGDAADHIAGFCLLND
WSARDIQAWEYQPLGPFLSKSFITSISPWVVTAEALEPFRRAQPARPEGDPQPLPYLFDK
RDQAAGAFDIELEVLLLTESMREQNLPAHRLTLSNTQHMYWTVAQMVAHHSVNGCQLQAG
DLFGSGTLSGPENGQFGSLLEITEGGKKPIELASGEVRKFLEDGDEIILRARCSREGFAS
IGFGECRGKVLPAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory