SitesBLAST
Comparing Pf1N1B4_1031 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1031 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P97852 Peroxisomal multifunctional enzyme type 2; MFE-2; 17-beta-hydroxysteroid dehydrogenase 4; 17-beta-HSD 4; D-bifunctional protein; DBP; Multifunctional protein 2; MFP-2; EC 1.1.1.n12; EC 4.2.1.107; EC 4.2.1.119 from Rattus norvegicus (Rat) (see paper)
60% identity, 99% coverage: 1:300/303 of query aligns to 1:301/735 of P97852
- 16:40 (vs. 16:40, 76% identical) binding
1gz6A (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 (see paper)
60% identity, 98% coverage: 5:300/303 of query aligns to 3:299/301 of 1gz6A
- active site: S149 (= S151), Y162 (= Y164), K166 (= K168)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G16), L19 (= L21), D38 (= D40), L39 (= L41), S73 (= S75), V74 (= V76), N97 (= N99), A98 (= A100), G99 (= G101), I100 (= I102), H121 (= H123), T147 (= T149), S149 (= S151), Y162 (= Y164), K166 (= K168), P192 (= P194), A194 (≠ G196), S196 (≠ T198), R197 (= R199), M198 (= M200)
P51659 Peroxisomal multifunctional enzyme type 2; MFE-2; 17-beta-hydroxysteroid dehydrogenase 4; 17-beta-HSD 4; D-bifunctional protein; DBP; Multifunctional protein 2; MFP-2; Short chain dehydrogenase/reductase family 8C member 1; EC 1.1.1.n12; EC 4.2.1.107; EC 4.2.1.119 from Homo sapiens (Human) (see 5 papers)
57% identity, 99% coverage: 1:300/303 of query aligns to 1:301/736 of P51659
- G16 (= G16) to S: in DBPD; no dehydrogenase activity; dbSNP:rs137853096
- R106 (≠ K106) to H: in dbSNP:rs25640
Sites not aligning to the query:
- 347 Y→A: No hydratase activity.
- 366 E→A: No hydratase activity.
- 370 D→A: No effect.
- 406 H→A: No effect.
- 408 E→A: No effect.
- 410 Y→A: No effect.
- 457 N → Y: in DBPD; the mutation leads to an unstable protein; dbSNP:rs137853097
- 490 D→A: No effect.
- 505 Y→A: Completely inactive.
- 510 D→A: No hydratase activity.
- 511 W → R: in dbSNP:rs11539471
- 515 H→A: Completely inactive.
- 517 D→A: No effect.
- 532 H→A: No effect.
- 559 I → V: in dbSNP:rs11205
1zbqA Crystal structure of human 17-beta-hydroxysteroid dehydrogenase type 4 in complex with NAD
58% identity, 98% coverage: 5:300/303 of query aligns to 3:299/302 of 1zbqA
- active site: S149 (= S151), Y162 (= Y164), K166 (= K168)
- binding nicotinamide-adenine-dinucleotide: G14 (= G16), G18 (= G20), L19 (= L21), D38 (= D40), L39 (= L41), S73 (= S75), V74 (= V76), N97 (= N99), A98 (= A100), T147 (= T149), S149 (= S151), Y162 (= Y164), K166 (= K168), P192 (= P194), N193 (≠ T195), A194 (≠ G196), S196 (≠ T198), R197 (= R199), M198 (= M200)
1gz6B (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 (see paper)
58% identity, 98% coverage: 5:300/303 of query aligns to 3:276/278 of 1gz6B
- active site: S141 (= S151), Y154 (= Y164), K158 (= K168)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G16), L19 (= L21), D38 (= D40), L39 (= L41), S65 (= S75), V66 (= V76), N89 (= N99), A90 (= A100), G91 (= G101), H113 (= H123), T139 (= T149), S141 (= S151), Y154 (= Y164), K158 (= K168), P184 (= P194)
P96825 Putative short-chain type dehydrogenase/reductase Rv0148; EC 1.1.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
56% identity, 90% coverage: 8:281/303 of query aligns to 5:279/286 of P96825
Sites not aligning to the query:
- 280 modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P22414 Peroxisomal hydratase-dehydrogenase-epimerase; HDE; Multifunctional beta-oxidation protein; MFP; EC 4.2.1.119; EC 1.1.1.n12 from Candida tropicalis (Yeast) (see paper)
52% identity, 93% coverage: 5:285/303 of query aligns to 4:284/906 of P22414
Sites not aligning to the query:
- 699 binding
- 700 binding
- 729 binding
- 757 binding
- 808 binding
- 810 binding
- 831 binding
- 856 binding
- 857 binding
- 858 binding
4nbuB Crystal structure of fabg from bacillus sp (see paper)
36% identity, 79% coverage: 6:244/303 of query aligns to 4:243/244 of 4nbuB
- active site: G18 (= G20), N111 (≠ H123), S139 (= S151), Q149 (= Q161), Y152 (= Y164), K156 (= K168)
- binding acetoacetyl-coenzyme a: D93 (= D105), K98 (= K110), S139 (= S151), N146 (= N158), V147 (≠ F159), Q149 (= Q161), Y152 (= Y164), F184 (≠ G196), M189 (≠ T201), K200 (≠ Q212)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G16), N17 (≠ G19), G18 (= G20), I19 (≠ L21), D38 (= D40), F39 (≠ L41), V59 (≠ E64), D60 (≠ A65), V61 (≠ G66), N87 (= N99), A88 (= A100), G89 (= G101), I90 (= I102), T137 (= T149), S139 (= S151), Y152 (= Y164), K156 (= K168), P182 (= P194), F184 (≠ G196), T185 (≠ G197), T187 (≠ R199), M189 (≠ T201)
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
34% identity, 78% coverage: 6:242/303 of query aligns to 2:236/239 of 4nbtA
- active site: G16 (= G20), S132 (= S151), Y145 (= Y164), K149 (= K168)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), K15 (≠ G19), G16 (= G20), L17 (= L21), D36 (= D40), L37 (= L41), L52 (≠ D74), N53 (≠ S75), V54 (= V76), N80 (= N99), A81 (= A100), G82 (= G101), I130 (≠ T149), S132 (= S151), Y145 (= Y164), K149 (= K168), P177 (= P194), G178 (= G197), I180 (≠ R199), T182 (= T201)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
38% identity, 78% coverage: 10:244/303 of query aligns to 7:245/247 of P73574
- A14 (= A17) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (≠ F159) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K168) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ T195) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ I205) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
36% identity, 80% coverage: 2:242/303 of query aligns to 1:244/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G16), R18 (≠ G19), G19 (= G20), I20 (≠ L21), D39 (= D40), R40 (≠ L41), C63 (≠ A71), I65 (≠ H73), N91 (= N99), G93 (= G101), I94 (= I102), V114 (= V122), Y155 (= Y164), K159 (= K168), I188 (vs. gap), T190 (= T198), T193 (= T201)
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
41% identity, 61% coverage: 11:194/303 of query aligns to 3:181/244 of 1edoA
- active site: G12 (= G20), S138 (= S151), Y151 (= Y164), K155 (= K168)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G16), S10 (≠ G18), R11 (≠ G19), I13 (≠ L21), N31 (= N39), Y32 (≠ E48), A33 (≠ G49), R34 (≠ A50), S35 (≠ N51), D59 (≠ S75), V60 (= V76), N86 (= N99), A87 (= A100), S138 (= S151), Y151 (= Y164), K155 (= K168), P181 (= P194)
Sites not aligning to the query:
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
35% identity, 69% coverage: 7:216/303 of query aligns to 3:196/248 of Q9KJF1
- S15 (≠ G19) binding
- D36 (= D40) binding
- D62 (≠ E70) binding
- I63 (≠ A71) binding
- N89 (= N99) binding
- Y153 (= Y164) binding
- K157 (= K168) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
35% identity, 69% coverage: 7:216/303 of query aligns to 2:195/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), M16 (≠ L21), D35 (= D40), I36 (≠ L41), I62 (≠ A71), N88 (= N99), G90 (= G101), I138 (≠ T149), S140 (= S151), Y152 (= Y164), K156 (= K168), I185 (= I205)
4k6fB X-ray crystal structure of a putative acetoacetyl-coa reductase from burkholderia cenocepacia bound to the co-factor NADP
32% identity, 75% coverage: 10:235/303 of query aligns to 2:233/245 of 4k6fB
- active site: G12 (= G20), N102 (≠ D115), S138 (= S151), Y151 (= Y164), K155 (= K168)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G16), Y32 (≠ E48), S33 (≠ G49), N36 (≠ A52), V58 (≠ D74), D59 (≠ S75), V60 (= V76), A87 (= A100), G88 (= G101), I89 (= I102)
7x5jC Acp-dependent oxoacyl reductase
35% identity, 78% coverage: 7:242/303 of query aligns to 2:250/256 of 7x5jC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G16), S13 (≠ G18), G15 (= G20), L16 (= L21), N36 (≠ G49), R37 (≠ A50), N38 (= N51), D62 (≠ S75), V63 (= V76), N89 (= N99), A90 (= A100), A91 (vs. gap), V114 (= V122), I141 (≠ T149), Y156 (= Y164), K160 (= K168), L186 (≠ P194), G187 (vs. gap), V188 (≠ T195), R194 (≠ T201), S197 (≠ L204), S198 (≠ I205)
4nbwA Crystal structure of fabg from plesiocystis pacifica (see paper)
37% identity, 75% coverage: 10:235/303 of query aligns to 2:240/253 of 4nbwA
- active site: G12 (= G20), S146 (= S151), Y159 (= Y164), K163 (= K168)
- binding nicotinamide-adenine-dinucleotide: G8 (= G16), N11 (≠ G19), G12 (= G20), I13 (≠ L21), D32 (= D40), L33 (= L41), V57 (≠ A71), D58 (≠ N72), V59 (≠ H73), N85 (= N99), A86 (= A100), G87 (= G101), S146 (= S151), Y159 (= Y164), K163 (= K168), I192 (vs. gap), T194 (= T198)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
33% identity, 77% coverage: 10:243/303 of query aligns to 2:237/239 of 3sj7A
- active site: G12 (= G20), S138 (= S151), Q148 (= Q161), Y151 (= Y164), K155 (= K168)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G16), S10 (≠ G18), R11 (≠ G19), I13 (≠ L21), N31 (= N39), Y32 (≠ D40), A33 (≠ L41), G34 (= G42), S35 (≠ G43), A58 (≠ D74), N59 (≠ S75), V60 (= V76), N86 (= N99), A87 (= A100), T109 (≠ V122), S138 (= S151), Y151 (= Y164), K155 (= K168), P181 (= P194), G182 (= G203)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
35% identity, 79% coverage: 7:244/303 of query aligns to 3:246/247 of 4jroC
- active site: G16 (= G20), S142 (= S151), Q152 (= Q161), Y155 (= Y164), K159 (= K168)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), S14 (≠ G18), R15 (≠ G19), G16 (= G20), I17 (≠ L21), N35 (= N39), Y36 (≠ L41), N37 (≠ G42), G38 (= G43), S39 (= S44), N63 (≠ S75), V64 (= V76), N90 (= N99), A91 (= A100), I93 (= I102), I113 (≠ V122), S142 (= S151), Y155 (= Y164), K159 (= K168), P185 (= P194), I188 (vs. gap), T190 (= T198)
7lgbA Chsb1 in complex with NAD+ (see paper)
37% identity, 75% coverage: 10:235/303 of query aligns to 6:236/282 of 7lgbA
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), G16 (= G20), L17 (= L21), D36 (= D40), V37 (≠ L41), G64 (vs. gap), D65 (≠ N72), I66 (≠ H73), N91 (= N99), A92 (= A100), G93 (= G101), I94 (= I102), V114 (= V122), T149 (= T149), S151 (= S151), Y164 (= Y164), K168 (= K168), P194 (= P194), T198 (= T198), M200 (= M200), T201 (= T201)
Query Sequence
>Pf1N1B4_1031 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1031
MNESVRFEDKVVIVTGAGGGLGRAHALLFAKQGAKVLVNDLGGSAQGEGANASAADRVVA
EIREAGGTAEANHDSVTDGDKIVQHALDTFGRVDVVVNNAGILRDKTFHKMDDSDWDLVY
RVHVEGAYKVTRAAWPHMREQNYGRVIFTASTSGIYGNFGQSNYGMAKLGLYGLTRTLAI
EGRKNNILVNAIAPTGGTRMTEGLIPPHVFEQLKPELVSPLVVYLASEHCQETSGLFEVG
GGWMGKVRWERSLGAGFDPRVGFSPEDVAAHWQQICDFEGAAHPKDNIEALKEMMENLQK
YSI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory