SitesBLAST
Comparing Pf1N1B4_1040 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1040 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5bt9C Crystal structure of folm alternative dihydrofolate reductase 1 from brucella canis complexed with NADP (see paper)
27% identity, 97% coverage: 7:235/236 of query aligns to 9:242/250 of 5bt9C
- active site: R18 (= R16), I140 (= I133), Y155 (= Y148), K159 (= K152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R18 (= R16), I19 (≠ V17), C38 (≠ S35), N39 (≠ Y36), R40 (= R37), S41 (= S38), L66 (≠ S60), E67 (= E61), N90 (= N84), S92 (= S86), I140 (= I133), K159 (= K152), P184 (= P177), G185 (≠ A178), T187 (≠ L180), L188 (= L181)
8bcjB Crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 in complex with NADP+
27% identity, 96% coverage: 8:233/236 of query aligns to 7:250/250 of 8bcjB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G12), S13 (≠ G14), R14 (≠ Q15), G15 (≠ R16), I16 (≠ V17), L36 (≠ R37), R37 (≠ S38), N38 (≠ E39), A61 (= A56), D62 (= D57), V63 (≠ F58), N89 (= N84), A90 (= A85), G91 (≠ S86), T113 (≠ V106), V143 (≠ I133), S145 (≠ D135), Y159 (= Y148), K163 (= K152), P189 (= P177), G190 (≠ A178), I192 (≠ L180), T194 (vs. gap), I196 (≠ L181), H197 (≠ F182)
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
27% identity, 96% coverage: 9:234/236 of query aligns to 10:239/241 of 5t2uA
- active site: G17 (≠ R16), T135 (≠ D135), T145 (≠ H145), Y148 (= Y148), K152 (= K152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), G17 (≠ R16), R38 (= R37), D39 (≠ S38), R42 (≠ P41), D60 (≠ E61), L61 (≠ A62), N83 (= N84), A84 (= A85), Y87 (≠ W88), I133 (= I133), T135 (≠ D135), Y148 (= Y148), K152 (= K152), P178 (= P177), P180 (vs. gap), T181 (vs. gap), T183 (vs. gap), T185 (≠ L179), T186 (≠ L180)
5iz4A Crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans
26% identity, 95% coverage: 9:232/236 of query aligns to 8:243/247 of 5iz4A
- active site: G15 (≠ R16), S150 (≠ D135), S159 (≠ K144), Y163 (= Y148), K167 (= K152)
- binding adenosine-5'-diphosphate: G11 (= G12), S14 (≠ Q15), G15 (≠ R16), I16 (≠ V17), F36 (vs. gap), A63 (= A56), D64 (= D57), V65 (≠ F58), A92 (≠ T75), G93 (≠ D76), V117 (= V106)
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
26% identity, 100% coverage: 1:235/236 of query aligns to 1:243/244 of 6wprA
- active site: G16 (≠ R16), S138 (≠ D135), Y151 (= Y148)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ G14), R15 (≠ Q15), T37 (≠ R37), L58 (≠ F67), D59 (≠ E70), V60 (≠ L71), N86 (≠ T92), A87 (≠ P93), G88 (= G94), I89 (vs. gap), I136 (= I133), Y151 (= Y148), K155 (= K152), P181 (= P177)
3iccA Crystal structure of a putative 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis at 1.87 a resolution (see paper)
30% identity, 95% coverage: 9:232/236 of query aligns to 11:252/255 of 3iccA
- active site: G18 (≠ R16), S148 (≠ D135), F158 (≠ H145), Y161 (= Y148), K165 (= K152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G12), S16 (≠ G14), R17 (≠ Q15), G18 (≠ R16), I19 (≠ V17), H37 (≠ S35), Y38 (= Y36), G39 (vs. gap), L66 (≠ F58), E67 (≠ S59), N98 (= N84), G100 (vs. gap), I146 (= I133), S148 (≠ D135), Y161 (= Y148), K165 (= K152), P191 (= P177), G192 (≠ A178), M198 (≠ P184), N199 (≠ D185)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
23% identity, 98% coverage: 1:232/236 of query aligns to 1:244/247 of 4jroC
- active site: G16 (≠ R16), S142 (≠ D135), Q152 (≠ H145), Y155 (= Y148), K159 (= K152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ G14), R15 (≠ Q15), G16 (≠ R16), I17 (≠ V17), N35 (≠ S35), Y36 (= Y36), N37 (≠ R37), G38 (≠ S38), S39 (≠ E39), N63 (≠ D57), V64 (≠ F58), N90 (= N84), A91 (= A85), I93 (vs. gap), I113 (≠ V106), S142 (≠ D135), Y155 (= Y148), K159 (= K152), P185 (= P177), I188 (≠ L180), T190 (≠ F182)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
25% identity, 96% coverage: 9:235/236 of query aligns to 5:239/239 of 3sj7A
- active site: G12 (≠ R16), S138 (≠ D135), Q148 (≠ H145), Y151 (= Y148), K155 (= K152)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G12), S10 (≠ G14), R11 (≠ Q15), I13 (≠ V17), N31 (≠ S35), Y32 (= Y36), A33 (≠ R37), G34 (≠ S38), S35 (≠ E39), A58 (= A56), N59 (≠ D57), V60 (≠ F58), N86 (= N84), A87 (= A85), T109 (≠ V106), S138 (≠ D135), Y151 (= Y148), K155 (= K152), P181 (= P177), G182 (≠ A178)
3o03A Quaternary complex structure of gluconate 5-dehydrogenase from streptococcus suis type 2 (see paper)
24% identity, 73% coverage: 9:180/236 of query aligns to 15:193/254 of 3o03A
- active site: G22 (≠ R16), S147 (≠ D135), V157 (≠ H145), Y160 (= Y148), K164 (= K152)
- binding calcium ion: S147 (≠ D135), M148 (≠ D136), P190 (= P177)
- binding D-gluconic acid: I99 (≠ L89), R101 (≠ E91), S147 (≠ D135), M149 (≠ V137), R154 (≠ S142), Y160 (= Y148)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G12), Y21 (≠ Q15), G22 (≠ R16), I23 (≠ V17), D42 (≠ Y36), I43 (≠ R37), L47 (vs. gap), D68 (= D57), V69 (≠ F58), N95 (= N84), A96 (= A85), G97 (≠ S86), I145 (= I133), Y160 (= Y148), K164 (= K152), P190 (= P177)
4bo9A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 5-(2-(furan-2-ylmethoxy) phenyl)-2-phenyltetrazole at 2.9a resolution (see paper)
26% identity, 96% coverage: 9:235/236 of query aligns to 11:234/235 of 4bo9A
4bo7A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with n-(2,3-dihydro-1h-inden- 5-yl)tetrazolo(1,5-b)pyridazin-6-amine at 2.6a resolution (see paper)
26% identity, 96% coverage: 9:235/236 of query aligns to 11:237/238 of 4bo7A
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
25% identity, 100% coverage: 1:235/236 of query aligns to 3:246/246 of 3osuA
6d9yB Crystal structure of a short chain dehydrogenase/reductase sdr from burkholderia phymatum with partially occupied NAD
27% identity, 72% coverage: 8:178/236 of query aligns to 12:189/251 of 6d9yB
- active site: G20 (≠ R16), S145 (≠ D135), Y158 (= Y148)
- binding nicotinamide-adenine-dinucleotide: G16 (= G12), R19 (≠ Q15), G20 (≠ R16), D40 (≠ S35), L41 (≠ Y36), V64 (≠ A56), D65 (= D57), Q66 (≠ F58), A93 (vs. gap), S145 (≠ D135), Y158 (= Y148), K162 (= K152), P188 (= P177), A189 (= A178)
Sites not aligning to the query:
4bnyA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 4-(2-phenylthieno(3,2-d) pyrimidin-4-yl)morpholine at 1.8a resolution (see paper)
25% identity, 96% coverage: 9:235/236 of query aligns to 10:238/239 of 4bnyA
4bnxA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 6-(4-(2-chloroanilino)- 1h-quinazolin-2-ylidene)cyclohexa-2, 4-dien-1-one at 2.3a resolution (see paper)
25% identity, 96% coverage: 9:235/236 of query aligns to 11:239/239 of 4bnxA
- active site: G18 (≠ R16), S134 (≠ D135), Y147 (= Y148), K151 (= K152)
- binding 6-[4-(2-chloroanilino)-1H-quinazolin-2-ylidene]cyclohexa-2,4-dien-1-one: V103 (≠ F104), N104 (≠ S105), L107 (≠ M108), A149 (= A150), G153 (= G154), G156 (≠ S157), F157 (≠ L158)
4bnzA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-methyl-n-phenylindole- 3-carboxamide at 2.5a resolution (see paper)
25% identity, 96% coverage: 9:235/236 of query aligns to 11:240/241 of 4bnzA
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
25% identity, 96% coverage: 9:235/236 of query aligns to 9:243/244 of P0A2C9
- M125 (≠ L122) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (≠ L217) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (≠ D218) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
1mxhA Crystal structure of substrate complex of putative pteridine reductase 2 (ptr2) from trypanosoma cruzi (see paper)
30% identity, 95% coverage: 9:232/236 of query aligns to 5:242/248 of 1mxhA
- active site: R12 (= R16), D141 (= D135), Y154 (= Y148), K158 (= K152)
- binding dihydrofolic acid: S93 (= S86), Y95 (≠ W88), D141 (= D135), F151 (≠ H145), Y154 (= Y148), P190 (≠ N183), Y201 (= Y190)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R12 (= R16), I13 (≠ V17), Y32 (= Y36), R33 (= R37), H34 (vs. gap), S35 (= S38), L61 (≠ I64), N91 (= N84), A92 (= A85), S93 (= S86), E110 (≠ R102), L139 (≠ I133), C140 (≠ S134), K158 (= K152), P184 (= P177), G185 (≠ A178), S187 (≠ L180), L188 (= L181)
1mxfA Crystal structure of inhibitor complex of putative pteridine reductase 2 (ptr2) from trypanosoma cruzi (see paper)
28% identity, 95% coverage: 9:232/236 of query aligns to 5:241/247 of 1mxfA
- active site: R12 (= R16), D140 (= D135), Y153 (= Y148), K157 (= K152)
- binding methotrexate: R12 (= R16), S93 (= S86), Y95 (≠ W88), Y153 (= Y148), P189 (≠ N183), M192 (vs. gap), Y200 (= Y190)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R12 (= R16), R33 (= R37), H34 (vs. gap), S35 (= S38), L61 (≠ I64), N91 (= N84), S93 (= S86), E111 (≠ R102), L138 (≠ I133), K157 (= K152), P183 (= P177), G184 (≠ A178), S186 (≠ L180)
5b1yB Crystal structure of NADPH bound carbonyl reductase from aeropyrum pernix (see paper)
26% identity, 96% coverage: 9:234/236 of query aligns to 7:242/243 of 5b1yB
- active site: G14 (≠ R16), V20 (≠ A22), S141 (≠ D135), Y155 (= Y148), K159 (= K152)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G10 (= G12), R13 (≠ Q15), I15 (≠ V17), Y34 (= Y36), K35 (≠ R37), S36 (= S38), R37 (≠ E39), V61 (vs. gap), D62 (vs. gap), V63 (vs. gap), A90 (≠ S86), G91 (≠ E87), V139 (≠ I133), S141 (≠ D135), Y155 (= Y148), K159 (= K152), F187 (= F182), V188 (≠ N183), T190 (≠ D185)
Query Sequence
>Pf1N1B4_1040 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1040
MTSTAAPILITGAGQRVGLHCAQRLLEDGHPVIFSYRSERPGVQTLRDLGASAVFADFSS
EAGILAFIGELKNHTDSLRAVVHNASEWLAETPGTEAAAFTRMFSVHMLAPYLINLHCAD
LLRRSSPADIVHISDDVTRRGSSKHIGYCASKAGLDSLTLSFAAKYAPSIKVNGIAPALL
LFNPDDDAAYRARVLAKSALGIEPGSEVIYQSLRYLLDNPYVTGTTLTVNGGRHVK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory