Comparing Pf1N1B4_1055 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1055 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
63% identity, 99% coverage: 1:418/422 of query aligns to 294:712/714 of Q8ZND6
Sites not aligning to the query:
6ioxA Crystal structure of porphyromonas gingivalis phosphotransacetylase in complex with acetyl-coa (see paper)
41% identity, 75% coverage: 101:415/422 of query aligns to 11:334/339 of 6ioxA
1xcoD Crystal structure of a phosphotransacetylase from bacillus subtilis in complex with acetylphosphate (see paper)
41% identity, 74% coverage: 103:415/422 of query aligns to 12:324/325 of 1xcoD
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
41% identity, 76% coverage: 97:416/422 of query aligns to 4:329/333 of P38503
Sites not aligning to the query:
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
41% identity, 76% coverage: 97:416/422 of query aligns to 3:328/332 of 2af3C
6zngF Maeb full-length acetyl-coa bound state (see paper)
33% identity, 78% coverage: 87:415/422 of query aligns to 414:743/753 of 6zngF
Sites not aligning to the query:
P76558 NADP-dependent malic enzyme; NADP-ME; EC 1.1.1.40 from Escherichia coli (strain K12) (see paper)
29% identity, 77% coverage: 96:420/422 of query aligns to 429:759/759 of P76558
Sites not aligning to the query:
3u9eB The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with coa.
29% identity, 34% coverage: 255:397/422 of query aligns to 129:273/288 of 3u9eB
Sites not aligning to the query:
3uf6A The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with cod (3'-dephosphocoenzyme a)
29% identity, 34% coverage: 255:397/422 of query aligns to 127:271/285 of 3uf6A
Sites not aligning to the query:
>Pf1N1B4_1055 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1055
MNGVPLAGLLLTSDTLPDPRIMDLCRGALQAGLPVLSVSTGSYETANQLNGLNKEIPIDD
RERAEIITDFVASHLDANWLHQRCGTPREMRLSPAVFRYQLIQRAQAANKRIVLPEGSEP
LTVQAAAICQARGIARCVLLAKPADVEAVARAQGIELPPGLEILDPDLIRERYVEPMVAL
RKTKSLNAPMAEQQLEDTVVIGTMMLALDEVDGLVSGVIHSTANTIRPALQLIKTAPGCT
LVSSVFFMLFPEEVLVYGDCVMNPHPSASELAEIALQSADSAAAFGITPRVAMISYSSGE
SASGEEVEKVREATLLAHEQQNSLLIDGPLQYDAAANETVARQLAPNSQVAGRATVFVFP
DLNTGNTTHKAVQRSADCVSLGPMLQGLRKPVNDLPRGAQVDDIVYTIALTAIQAANRPM
DV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory