Comparing Pf1N1B4_1093 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1093 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q94JV5 Deaminated glutathione amidase, chloroplastic/cytosolic; dGSH amidase; Nitrilase-like protein 2; Protein nitrilase 1 homolog; AtNit1; Protein Nit1 homolog; EC 3.5.1.128 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
42% identity, 94% coverage: 3:268/284 of query aligns to 39:302/307 of Q94JV5
Sites not aligning to the query:
4hg5A Structural insights into yeast nit2: wild-type yeast nit2 in complex with oxaloacetate (see paper)
34% identity, 94% coverage: 3:269/284 of query aligns to 5:299/304 of 4hg5A
4hg3A Structural insights into yeast nit2: wild-type yeast nit2 in complex with alpha-ketoglutarate (see paper)
34% identity, 94% coverage: 3:269/284 of query aligns to 5:299/304 of 4hg3A
P47016 Deaminated glutathione amidase; dGSH amidase; Nitrilase homolog 1; EC 3.5.1.128 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
34% identity, 94% coverage: 3:269/284 of query aligns to 8:302/307 of P47016
4hgdA Structural insights into yeast nit2: c169s mutant of yeast nit2 in complex with an endogenous peptide-like ligand (see paper)
33% identity, 94% coverage: 3:269/284 of query aligns to 4:295/299 of 4hgdA
Q9NQR4 Omega-amidase NIT2; Nitrilase homolog 2; EC 3.5.1.3 from Homo sapiens (Human) (see 2 papers)
33% identity, 94% coverage: 3:269/284 of query aligns to 6:265/276 of Q9NQR4
6ypaB The c146a variant of an amidase from pyrococcus horikoshii with bound glutaramide
28% identity, 86% coverage: 1:243/284 of query aligns to 9:234/269 of 6ypaB
7ovgA The c146a variant of an amidase from pyrococcus horikoshii with bound acetamide (see paper)
28% identity, 86% coverage: 1:243/284 of query aligns to 3:228/263 of 7ovgA
P46011 Bifunctional nitrilase/nitrile hydratase NIT4; Cyanoalanine nitrilase; Nitrilase 4; EC 3.5.5.1; EC 3.5.5.4; EC 4.2.1.65 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 90% coverage: 13:267/284 of query aligns to 49:323/355 of P46011
3klcB Crystal structure of hyperthermophilic nitrilase (see paper)
28% identity, 86% coverage: 1:243/284 of query aligns to 1:226/261 of 3klcB
Sites not aligning to the query:
3klcA Crystal structure of hyperthermophilic nitrilase (see paper)
28% identity, 86% coverage: 1:243/284 of query aligns to 1:226/261 of 3klcA
Q9UYV8 Nitrilase; PaNit; EC 3.5.5.1 from Pyrococcus abyssi (strain GE5 / Orsay) (see paper)
28% identity, 86% coverage: 1:243/284 of query aligns to 2:227/262 of Q9UYV8
5h8jB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine (see paper)
23% identity, 94% coverage: 3:269/284 of query aligns to 7:280/297 of 5h8jB
5h8iC Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine (see paper)
23% identity, 94% coverage: 3:269/284 of query aligns to 11:284/301 of 5h8iC
5h8lB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine (see paper)
23% identity, 94% coverage: 3:269/284 of query aligns to 8:281/298 of 5h8lB
Q9UBR1 Beta-ureidopropionase; BUP-1; Beta-alanine synthase; N-carbamoyl-beta-alanine amidohydrolase; EC 3.5.1.6 from Homo sapiens (Human) (see 4 papers)
25% identity, 70% coverage: 22:221/284 of query aligns to 101:297/384 of Q9UBR1
Sites not aligning to the query:
Q44185 N-carbamoyl-D-amino acid hydrolase; D-N-alpha-carbamilase; EC 3.5.1.77 from Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter) (see paper)
26% identity, 75% coverage: 24:237/284 of query aligns to 31:260/304 of Q44185
Q964D8 Beta-ureidopropionase; Beta-alanine synthase; N-carbamoyl-beta-alanine amidohydrolase; EC 3.5.1.6 from Dictyostelium discoideum (Social amoeba)
22% identity, 74% coverage: 11:221/284 of query aligns to 93:300/391 of Q964D8
Sites not aligning to the query:
P11436 Aliphatic amidase; Acylamide amidohydrolase; EC 3.5.1.4 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
24% identity, 88% coverage: 18:267/284 of query aligns to 32:275/346 of P11436
O25067 Aliphatic amidase; Acylamide amidohydrolase; EC 3.5.1.4 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
24% identity, 87% coverage: 10:255/284 of query aligns to 27:261/339 of O25067
>Pf1N1B4_1093 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1093
MSVAVIQMVSQSDVLVNLAQARRLLEQAATGGARLAVLPENFAAMGRRDIADIGRAEALG
EGPILPWLKQTARDLKLWIVAGTLPLPPVDQPTAKVHACSLLVDDCGETVARYDKLHLFD
VDVADNRGRYRESDDYAYGSGVVVADTPVGRVGLTVCYDLRFPELYSELRAAGAELITAP
SAFTAVTGAAHWDVLIRARAIETQCYMLAAAQGGTHPGPRETFGHAAIVDPWGRVLAQQD
QGEAVLLAQRDSSEQASIRARMPVSTHRRFFSQGAQRPASERRI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory