Comparing Pf1N1B4_11 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_11 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5bntC X-ray crystal structure of a aspartate-semialdehyde dehydrogenase bound to NADP from pseudomonas aeruginosa
89% identity, 100% coverage: 1:370/370 of query aligns to 2:371/371 of 5bntC
4r5mA Crystal structure of vc-aspartate beta-semialdehyde-dehydrogenase with NADP and 4-nitro-2-phosphono-benzoic acid (see paper)
70% identity, 99% coverage: 3:368/370 of query aligns to 2:367/369 of 4r5mA
1mb4A Crystal structure of aspartate semialdehyde dehydrogenase from vibrio cholerae with NADP and s-methyl-l-cysteine sulfoxide (see paper)
70% identity, 99% coverage: 3:368/370 of query aligns to 2:367/369 of 1mb4A
3pzrA Crystals structure of aspartate beta-semialdehyde dehydrogenase from vibrio cholerae with NADP and product of s-carbamoyl-l-cysteine (see paper)
70% identity, 99% coverage: 3:368/370 of query aligns to 2:367/370 of 3pzrA
Q9KQG2 Aspartate-semialdehyde dehydrogenase 1; ASA dehydrogenase 1; ASADH 1; Aspartate-beta-semialdehyde dehydrogenase 1; EC 1.2.1.11 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (see paper)
70% identity, 99% coverage: 3:368/370 of query aligns to 2:367/370 of Q9KQG2
1gl3A Aspartate beta-semialdehyde dehydrogenase in complex with NADP and substrate analogue s-methyl cysteine sulfoxide (see paper)
70% identity, 99% coverage: 1:367/370 of query aligns to 1:366/367 of 1gl3A
P0A9Q9 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Escherichia coli (strain K12) (see 2 papers)
70% identity, 99% coverage: 1:367/370 of query aligns to 1:366/367 of P0A9Q9
7tcmA Crystal structure of aspartate-semialdehyde dehydrogenase from acinetobacter baumannii in complex with NADP
69% identity, 99% coverage: 3:369/370 of query aligns to 4:370/373 of 7tcmA
P44801 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
66% identity, 99% coverage: 1:368/370 of query aligns to 1:370/371 of P44801
1pquA Crystal structure of the h277n mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae bound with NADP, s-methyl cysteine sulfoxide and cacodylate (see paper)
66% identity, 99% coverage: 1:368/370 of query aligns to 1:370/371 of 1pquA
1tb4A Crystal structure of aspartate-semialdehyde dehydrogenase from haemophilus influenzae with a bound periodate (see paper)
65% identity, 99% coverage: 1:368/370 of query aligns to 1:356/357 of 1tb4A
1ta4A Crystal structure of aspartate-semialdehyde dehydrogenase from haemophilus influenzae with a bound arsenate (see paper)
65% identity, 99% coverage: 1:368/370 of query aligns to 1:356/357 of 1ta4A
1nx6A Crystal structure of aspartate semialdehyde dehydrogenase from haemophilus influenzae as a tetrahedral hemithiocetal reaction intermediate with phosphate at 2.15 a (see paper)
65% identity, 99% coverage: 1:368/370 of query aligns to 1:356/357 of 1nx6A
1pqpA Crystal structure of the c136s mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae bound with aspartate semialdehyde and phosphate (see paper)
64% identity, 99% coverage: 1:368/370 of query aligns to 1:356/357 of 1pqpA
Q04797 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Bacillus subtilis (strain 168) (see paper)
26% identity, 96% coverage: 3:357/370 of query aligns to 6:330/346 of Q04797
P23247 Aspartate-semialdehyde dehydrogenase 2; ASA dehydrogenase 2; ASADH 2; Aspartate-beta-semialdehyde dehydrogenase 2; EC 1.2.1.11 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (see paper)
25% identity, 99% coverage: 4:368/370 of query aligns to 7:333/337 of P23247
2r00C Crystal structure of aspartate semialdehyde dehydrogenase ii complexed with asa from vibrio cholerae (see paper)
25% identity, 99% coverage: 4:368/370 of query aligns to 6:332/336 of 2r00C
4r51A Crystal complex structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide adenine dinucleotide phosphate and phthalic acid (see paper)
25% identity, 99% coverage: 4:370/370 of query aligns to 4:343/360 of 4r51A
3pylC Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with d-2,3-diaminopropionate (see paper)
25% identity, 99% coverage: 4:370/370 of query aligns to 4:343/361 of 3pylC
3q11A Crystals structure of aspartate beta-semialdehyde dehydrogenase from streptococcus pneumoniae with NADP and aspartyl beta- difluorophosphonate (see paper)
25% identity, 99% coverage: 4:370/370 of query aligns to 4:343/358 of 3q11A
>Pf1N1B4_11 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_11
MKRVGLIGWRGMVGSVLMQRMLEEQDFDLIEPVFFTTSNVGGQGPSVGKDIAPLKDAYSI
EELKTLDVILTCQGGDYTSEVFPKLREAGWQGYWIDAASSLRMQDDAVIVLDPVNRKVID
QQLDAGTKNYIGGNCTVSLMLMGLGGLFEAGLVEWMSAMTYQAASGGGAQHMRELIKQMG
VTHAAVADQLADPASAILDIDRRVAEAMRSDAYPTENFGVPLAGSLIPWIDKELPNGQSR
EEWKAQAETNKILGRFKSPIPVDGICVRIGAMRCHSQALTIKLNKDVPIADIEGLISQHN
PWVKLVPNNREISMQELSPTKVTGTLNVPVGRLRKLNMGSQFVGAFTVGDQLLWGAAEPL
RRMLRILLER
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory