Comparing Pf1N1B4_1164 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1164 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4mvaA 1.43 angstrom resolution crystal structure of triosephosphate isomerase (tpia) from escherichia coli in complex with acetyl phosphate. (see paper)
48% identity, 99% coverage: 1:245/247 of query aligns to 5:249/255 of 4mvaA
B1XB85 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Escherichia coli (strain K12 / DH10B) (see paper)
48% identity, 99% coverage: 1:245/247 of query aligns to 5:249/255 of B1XB85
6neeB Crystal structure of a reconstructed ancestor of triosephosphate isomerase from eukaryotes (see paper)
50% identity, 99% coverage: 1:244/247 of query aligns to 7:250/252 of 6neeB
1aw1A Triosephosphate isomerase of vibrio marinus complexed with 2- phosphoglycolate (see paper)
46% identity, 95% coverage: 1:234/247 of query aligns to 4:239/255 of 1aw1A
P50921 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Moritella marina (Vibrio marinus) (see paper)
46% identity, 95% coverage: 1:234/247 of query aligns to 5:240/256 of P50921
P00942 Triosephosphate isomerase; TIM; Triose-phosphate isomerase; EC 5.3.1.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
44% identity, 96% coverage: 1:236/247 of query aligns to 6:239/248 of P00942
Sites not aligning to the query:
5zfxB Crystal structure of triosephosphate isomerase from opisthorchis viverrini (see paper)
47% identity, 99% coverage: 1:244/247 of query aligns to 4:246/248 of 5zfxB
6ooiC Crystal structure of triosephosphate isomerase from schistosoma mansoni in complex with 2pg (see paper)
45% identity, 99% coverage: 1:244/247 of query aligns to 11:253/255 of 6ooiC
4y96A Crystal structure of triosephosphate isomerase from gemmata obscuriglobus (see paper)
46% identity, 100% coverage: 1:246/247 of query aligns to 5:250/250 of 4y96A
3ypiA Electrophilic catalysis in triosephosphase isomerase: the role of histidine-95 (see paper)
44% identity, 96% coverage: 1:236/247 of query aligns to 5:238/247 of 3ypiA
4ff7B Structure of c126s mutant of saccharomyces cerevisiae triosephosphate isomerase (see paper)
44% identity, 96% coverage: 1:236/247 of query aligns to 5:238/247 of 4ff7B
4ff7A Structure of c126s mutant of saccharomyces cerevisiae triosephosphate isomerase (see paper)
44% identity, 96% coverage: 1:236/247 of query aligns to 5:238/247 of 4ff7A
P36204 Bifunctional PGK/TIM; EC 2.7.2.3; EC 5.3.1.1 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
48% identity, 95% coverage: 1:234/247 of query aligns to 405:639/654 of P36204
Sites not aligning to the query:
4pocB Structure of triosephosphate isomerase wild type human enzyme. (see paper)
47% identity, 99% coverage: 1:244/247 of query aligns to 6:245/247 of 4pocB
P60174 Triosephosphate isomerase; TIM; Methylglyoxal synthase; Triose-phosphate isomerase; EC 5.3.1.1; EC 4.2.3.3 from Homo sapiens (Human) (see 7 papers)
47% identity, 99% coverage: 1:244/247 of query aligns to 8:247/249 of P60174
1htiB Crystal structure of recombinant human triosephosphate isomerase at 2.8 angstroms resolution. Triosephosphate isomerase related human genetic disorders and comparison with the trypanosomal enzyme (see paper)
47% identity, 99% coverage: 1:244/247 of query aligns to 7:246/248 of 1htiB
P00939 Triosephosphate isomerase; TIM; Methylglyoxal synthase; Triose-phosphate isomerase; EC 5.3.1.1; EC 4.2.3.3 from Oryctolagus cuniculus (Rabbit) (see 2 papers)
46% identity, 99% coverage: 1:244/247 of query aligns to 8:247/249 of P00939
4owgA Crystal structure of rabbit muscle triosephosphate isomerase-pep complex
46% identity, 99% coverage: 1:244/247 of query aligns to 5:244/246 of 4owgA
1r2rB Crystal structure of rabbit muscle triosephosphate isomerase (see paper)
46% identity, 99% coverage: 1:244/247 of query aligns to 6:245/247 of 1r2rB
P17751 Triosephosphate isomerase; TIM; Methylglyoxal synthase; Triose-phosphate isomerase; EC 5.3.1.1; EC 4.2.3.3 from Mus musculus (Mouse) (see paper)
47% identity, 99% coverage: 1:244/247 of query aligns to 8:247/249 of P17751
>Pf1N1B4_1164 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1164
MVAGNWKMHGTRASVAELINGLGHLALPSGVDVAVFPPCLHINQVIDGLKGKSISVGAQN
SAVESMQGALTGEIAPSQLVDAGCSLVLVGHSERRQIMGEQDGMLIRKFAAAQACGLIPV
LCVGETLEEREAGKTLEVVGRQLGSIIEELGVGVFAKAVIAYEPVWAIGTGLTASPQQAQ
DVHAAIRAQLAAENSEVAQGVRLLYGGSVKAANAVELFGMPDIDGGLIGGASLNADEFGA
ICRAAGN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory