Comparing Pf1N1B4_1226 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1226 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
33% identity, 28% coverage: 33:124/323 of query aligns to 74:182/186 of 4isxA
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
32% identity, 33% coverage: 18:123/323 of query aligns to 76:181/190 of 5u2kA
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
30% identity, 33% coverage: 19:123/323 of query aligns to 57:181/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
30% identity, 33% coverage: 19:123/323 of query aligns to 57:181/201 of 1kruA
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
30% identity, 33% coverage: 19:123/323 of query aligns to 57:181/200 of 1krrA
Sites not aligning to the query:
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 33% coverage: 19:123/323 of query aligns to 58:182/203 of P07464
Sites not aligning to the query:
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
32% identity, 28% coverage: 33:123/323 of query aligns to 76:183/188 of 3igjC
7uujA Crystal structure of aminoglycoside resistance enzyme apma, complex with gentamicin
31% identity, 32% coverage: 25:126/323 of query aligns to 131:232/272 of 7uujA
Sites not aligning to the query:
7jm2A Crystal structure of aminoglycoside resistance enzyme apma, complex with apramycin
31% identity, 32% coverage: 25:126/323 of query aligns to 131:232/272 of 7jm2A
Sites not aligning to the query:
7jm1A Crystal structure of aminoglycoside resistance enzyme apma, complex with acetyl-coa
31% identity, 32% coverage: 25:126/323 of query aligns to 131:232/272 of 7jm1A
Sites not aligning to the query:
7uunA Crystal structure of aminoglycoside resistance enzyme apma, complex with neomycin (see paper)
31% identity, 32% coverage: 25:126/323 of query aligns to 132:233/273 of 7uunA
Sites not aligning to the query:
7uumA Crystal structure of aminoglycoside resistance enzyme apma, complex with paromomycin and coenzyme a (see paper)
31% identity, 32% coverage: 25:126/323 of query aligns to 133:234/274 of 7uumA
Sites not aligning to the query:
7uulA Crystal structure of aminoglycoside resistance enzyme apma, complex with kanamycin b and coenzyme a (see paper)
31% identity, 32% coverage: 25:126/323 of query aligns to 132:233/274 of 7uulA
Sites not aligning to the query:
7uukC Crystal structure of aminoglycoside resistance enzyme apma, complex with tobramycin (see paper)
31% identity, 32% coverage: 25:126/323 of query aligns to 133:234/276 of 7uukC
Sites not aligning to the query:
3nz2C Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
31% identity, 28% coverage: 32:123/323 of query aligns to 70:178/183 of 3nz2C
Sites not aligning to the query:
3ectA Crystal structure of the hexapeptide-repeat containing- acetyltransferase vca0836 from vibrio cholerae
31% identity, 28% coverage: 32:123/323 of query aligns to 63:171/176 of 3ectA
3nz2J Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
31% identity, 28% coverage: 32:123/323 of query aligns to 73:181/185 of 3nz2J
Sites not aligning to the query:
4mzuF Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
28% identity, 58% coverage: 2:189/323 of query aligns to 15:203/294 of 4mzuF
Sites not aligning to the query:
1kk4A Crystal structure of vat(d) in complex with acetyl-coa (see paper)
46% identity, 18% coverage: 70:126/323 of query aligns to 107:167/205 of 1kk4A
Sites not aligning to the query:
1mrlA Crystal structure of streptogramin a acetyltransferase with dalfopristin (see paper)
46% identity, 18% coverage: 70:126/323 of query aligns to 107:167/204 of 1mrlA
Sites not aligning to the query:
>Pf1N1B4_1226 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1226
VDDTNVVEVLTTIDSGSELGRHVWIRAASRLQNVQLGDDCFVGFKSDLRFVAIGKASMLA
TGVQCLGTAQSPIQIGANAWLGAKVTVKAGVSIGAGAVVAAGALVVSDIPPDAIAVGRPA
RIIAYRSVVEDGAPSPEHVLAKVRERARQGMPSLLDRASLSVARLKELNPDTQTWDISED
TLIDAELRGGASVEIARDCILIGRSVRQGGMSQLGGIDIGTGTSLGEGIVIEAAGGVTIG
AFSELGARVTVVTSSHDHSFRSLPWEEAPVHIGSRCVIGEGAIIVGPLSIGDGAVIKPYS
VVIRDVLENTVVNGVVQLMEIQE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory