Comparing Pf1N1B4_1339 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1339 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
38% identity, 71% coverage: 86:315/323 of query aligns to 27:260/265 of P07821
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
35% identity, 64% coverage: 86:291/323 of query aligns to 17:224/240 of 4ymuJ
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
33% identity, 64% coverage: 86:292/323 of query aligns to 18:225/241 of 4u00A
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 67% coverage: 86:300/323 of query aligns to 19:242/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
30% identity, 67% coverage: 86:300/323 of query aligns to 19:242/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
30% identity, 67% coverage: 86:300/323 of query aligns to 19:242/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
30% identity, 67% coverage: 86:300/323 of query aligns to 19:242/242 of 2oljA
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 64% coverage: 86:292/323 of query aligns to 21:230/343 of P30750
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
32% identity, 63% coverage: 88:292/323 of query aligns to 44:252/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
32% identity, 63% coverage: 88:292/323 of query aligns to 44:252/382 of 7aheC
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
32% identity, 64% coverage: 86:292/323 of query aligns to 22:231/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
32% identity, 64% coverage: 86:292/323 of query aligns to 22:231/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
32% identity, 64% coverage: 86:292/323 of query aligns to 22:231/344 of 6cvlD
Sites not aligning to the query:
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
31% identity, 71% coverage: 65:292/323 of query aligns to 2:226/276 of Q5M243
7ahdC Opua (e190q) occluded (see paper)
31% identity, 63% coverage: 88:292/323 of query aligns to 44:252/260 of 7ahdC
Sites not aligning to the query:
3d31A Modbc from methanosarcina acetivorans (see paper)
33% identity, 64% coverage: 84:291/323 of query aligns to 14:216/348 of 3d31A
Sites not aligning to the query:
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
34% identity, 63% coverage: 88:290/323 of query aligns to 20:226/253 of 6z5uK
Sites not aligning to the query:
5x40A Structure of a cbio dimer bound with amppcp (see paper)
35% identity, 64% coverage: 86:292/323 of query aligns to 21:229/280 of 5x40A
Sites not aligning to the query:
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
34% identity, 63% coverage: 88:290/323 of query aligns to 22:228/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
34% identity, 63% coverage: 88:290/323 of query aligns to 22:228/263 of 7d08B
Sites not aligning to the query:
>Pf1N1B4_1339 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1339
MTAGSGSSAIRDRFSSPLTAPFDPRASSRASPLPQESRNPCGSGLARDGAISNTENAKGT
RMTSLNLTNLAWTPLGHGHCHHQFQLRDASLHVAAGEFVGLIGPNGSGKTSLLRCAYRFS
KPERGEVKLDHYNVWKQSSRWCAQRIAVVLQEFPDAFGLSVDEVVVMGRTPHKGLFDGDT
LEDRKLAAHALESVGLKGFEDHAFATLSGGEKQRVILARALAQQPQLLILDEPTNHLDPR
YQLELLQLVKRLQIGTLASIHDLNLAAAFCDRLYVINHGRIVASGPPKEVLTAQLLHNVF
GVDALIDDHPLHGYPRITWITQP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory