SitesBLAST – Find functional sites

 

SitesBLAST

Comparing Pf1N1B4_1347 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1347 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 20 (the maximum) hits to proteins with known functional sites (download)

1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
43% identity, 98% coverage: 1:227/232 of query aligns to 6:233/240 of 1ji0A

query
sites
1ji0A
M
 
V
L
 
L
Q
 
E
V
 
V
D
 
Q
T
 
S
L
 
L
H
 
H
Q
 
V
Y
 
Y
Y
|
Y
G
 
G
G
 
A
S
 
I
H
 
H
I
 
A
L
 
I
R
 
K
G
 
G
L
 
I
T
 
D
F
 
L
E
 
K
V
 
V
K
 
P
V
 
R
G
 
G
E
 
Q
V
 
I
T
 
V
C
 
T
L
 
L
L
 
I
G
 
G
R
 
A
N
 
N
G
|
G
V
 
A
G
|
G
K
|
K
T
|
T
T
|
T
L
 
T
L
 
L
K
 
S
C
 
A
L
 
I
M
 
A
G
 
G
L
 
L
L
 
V
P
 
R
A
 
A
K
 
Q
E
 
K
G
 
G
A
 
K
V
 
I
N
 
I
W
 
F
E
 
N
G
 
G
K
 
Q
P
 
D
I
 
I
T
 
T
T
 
N
F
 
K
K
 
P
P
 
A
H
 
H
Q
 
V
R
 
I
V
 
N
H
 
R
A
 
M
G
 
G
I
 
I
A
 
A
Y
 
L
V
 
V
P
 
P
Q
x
E
G
 
G
R
 
R
E
 
R
I
 
I
F
 
F
G
 
P
R
 
E
L
 
L
T
 
T
V
 
V
E
 
Y
E
 
E
N
 
N
L
 
L
L
 
M
M
 
M
G
 
G
L
 
A
S
 
Y
R
 
N
F
 
R
P
 
K
G
 
D
S
 
K
E
 
E
A
 
G
-
 
I
K
 
K
E
 
R
V
 
D
P
 
L
A
 
E
F
 
W
I
 
I
Y
 
F
E
 
S
L
 
L
F
 
F
P
 
P
V
 
R
L
 
L
L
 
K
Q
 
E
M
 
R
K
 
L
Q
 
K
R
 
Q
R
 
L
G
 
G
G
 
G
D
 
T
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
E
Q
 
Q
Q
 
Q
Q
 
M
L
 
L
A
 
A
I
 
I
G
 
G
R
 
R
A
 
A
L
 
L
A
 
M
S
 
S
R
 
R
P
 
P
R
 
K
L
 
L
L
 
L
I
 
M
L
 
M
D
 
D
E
|
E
P
 
P
T
 
S
E
 
L
G
 
G
I
 
L
Q
 
A
P
 
P
S
 
I
V
 
L
I
 
V
K
 
S
E
 
E
I
 
V
G
 
F
A
 
E
V
 
V
I
 
I
K
 
Q
Q
 
K
L
 
I
A
 
N
A
 
Q
R
 
E
G
 
G
D
 
T
M
 
-
A
 
T
I
 
I
L
 
L
L
 
L
V
 
V
E
 
E
Q
 
Q
F
 
N
Y
 
A
D
 
L
F
 
G
A
 
A
A
 
L
E
 
K
L
 
V
A
 
A
D
 
H
Q
 
Y
Y
 
G
L
 
Y
V
 
V
M
 
L
S
 
E
R
 
T
G
 
G
E
 
Q
I
 
I
V
 
V
Q
 
L
Q
 
E
G
 
G
R
 
K
G
 
A
-
 
S
E
 
E
N
 
L
M
 
L
E
 
D
A
 
N
E
 
E
G
 
M
V
 
V
R
 
R

1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 94% coverage: 1:219/232 of query aligns to 4:235/254 of 1g6hA

query
sites
1g6hA
M
 
I
L
 
L
Q
 
R
V
 
T
D
 
E
T
 
N
L
 
I
H
 
V
Q
 
K
Y
 
Y
Y
x
F
G
 
G
G
 
E
S
x
F
H
 
K
I
 
A
L
 
L
R
 
D
G
 
G
L
 
V
T
 
S
F
 
I
E
 
S
V
 
V
K
 
N
V
 
K
G
 
G
E
 
D
V
 
V
T
 
T
C
 
L
L
 
I
L
 
I
G
 
G
R
 
P
N
|
N
G
|
G
V
 
S
G
|
G
K
|
K
T
x
S
T
|
T
L
 
L
L
 
I
K
 
N
C
 
V
L
 
I
M
 
T
G
 
G
L
 
F
L
 
L
P
 
K
A
 
A
K
 
D
E
 
E
G
 
G
A
 
R
V
 
V
N
 
Y
W
 
F
E
 
E
G
 
N
K
 
K
P
 
D
I
 
I
T
 
T
T
 
N
F
 
K
K
 
E
P
 
P
H
 
A
Q
 
E
R
 
L
V
 
Y
H
 
H
A
 
Y
G
 
G
I
 
I
A
 
V
Y
 
R
V
 
T
P
 
F
Q
 
Q
G
 
T
R
 
P
E
 
Q
I
 
P
F
 
L
G
 
K
R
 
E
L
 
M
T
 
T
V
 
V
E
 
L
E
 
E
N
 
N
L
 
L
L
 
L
M
 
I
G
 
G
-
 
E
-
 
I
-
 
C
-
 
P
-
 
G
-
 
E
-
 
S
-
 
P
-
 
L
-
 
N
-
 
S
-
 
L
-
 
F
-
 
Y
L
 
K
S
 
K
R
 
W
F
 
I
P
 
P
G
 
K
S
 
E
E
 
E
A
 
E
K
 
M
E
 
V
V
 
E
P
 
K
A
 
A
F
 
F
I
 
K
Y
 
I
E
 
L
L
 
E
F
 
F
P
 
L
V
 
K
L
 
L
L
 
S
Q
 
H
M
 
L
K
 
Y
Q
 
D
R
 
R
R
 
K
G
 
A
G
 
G
D
 
E
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
Q
Q
 
M
Q
 
K
Q
 
L
L
 
V
A
 
E
I
 
I
G
 
G
R
 
R
A
 
A
L
 
L
A
 
M
S
 
T
R
 
N
P
 
P
R
 
K
L
 
M
L
 
I
I
 
V
L
 
M
D
 
D
E
 
E
P
 
P
T
 
I
E
 
A
G
 
G
I
 
V
Q
 
A
P
 
P
S
 
G
V
 
L
I
 
A
K
 
H
E
 
D
I
 
I
G
 
F
A
 
N
V
 
H
I
 
V
K
 
L
Q
 
E
L
 
L
A
 
K
A
 
A
R
 
K
G
 
G
D
 
-
M
 
I
A
 
T
I
 
F
L
 
L
L
 
I
V
 
I
E
 
E
Q
 
H
F
 
R
Y
 
L
D
 
D
F
 
I
A
 
V
A
 
L
E
 
N
L
 
Y
A
 
I
D
 
D
Q
 
H
Y
 
L
L
 
Y
V
 
V
M
 
M
S
 
F
R
 
N
G
 
G
E
 
Q
I
 
I
V
 
I
Q
 
A
Q
 
E
G
 
G
R
 
R
G
 
G
E
 
E

1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 94% coverage: 1:219/232 of query aligns to 4:235/253 of 1g9xB

query
sites
1g9xB
M
 
I
L
 
L
Q
 
R
V
 
T
D
 
E
T
 
N
L
 
I
H
 
V
Q
 
K
Y
 
Y
Y
x
F
G
 
G
G
 
E
S
x
F
H
 
K
I
 
A
L
 
L
R
 
D
G
 
G
L
 
V
T
 
S
F
 
I
E
 
S
V
 
V
K
 
C
V
 
K
G
 
G
E
 
D
V
 
V
T
 
T
C
 
L
L
 
I
L
 
I
G
 
G
R
 
P
N
 
N
G
|
G
V
x
S
G
|
G
K
|
K
T
x
S
T
|
T
L
 
L
L
 
I
K
 
N
C
 
V
L
 
I
M
 
T
G
 
G
L
 
F
L
 
L
P
 
K
A
 
A
K
 
D
E
 
E
G
 
G
A
 
R
V
 
V
N
 
Y
W
 
F
E
 
E
G
 
N
K
 
K
P
 
D
I
 
I
T
 
T
T
 
N
F
 
K
K
 
E
P
 
P
H
 
A
Q
 
E
R
 
L
V
 
Y
H
 
H
A
 
Y
G
 
G
I
 
I
A
 
V
Y
 
R
V
 
T
P
 
F
Q
 
Q
G
 
T
R
 
P
E
 
Q
I
 
P
F
 
L
G
 
K
R
 
E
L
 
M
T
 
T
V
 
V
E
 
L
E
 
E
N
 
N
L
 
L
L
 
L
M
 
I
G
 
G
-
 
E
-
 
I
-
 
N
-
 
P
-
 
G
-
 
E
-
 
S
-
 
P
-
 
L
-
 
N
-
 
S
-
 
L
-
 
F
-
 
Y
L
 
K
S
 
K
R
 
W
F
 
I
P
 
P
G
 
K
S
 
E
E
 
E
A
 
E
K
 
M
E
 
V
V
 
E
P
 
K
A
 
A
F
 
F
I
 
K
Y
 
I
E
 
L
L
 
E
F
 
F
P
 
L
V
 
K
L
 
L
L
 
S
Q
 
H
M
 
L
K
 
Y
Q
 
D
R
 
R
R
 
K
G
 
A
G
 
G
D
 
E
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
Q
Q
 
M
Q
 
K
Q
 
L
L
 
V
A
 
E
I
 
I
G
 
G
R
 
R
A
 
A
L
 
L
A
 
M
S
 
T
R
 
N
P
 
P
R
 
K
L
 
M
L
 
I
I
 
V
L
 
M
D
 
D
E
|
E
P
 
P
T
 
I
E
 
A
G
 
G
I
 
V
Q
 
A
P
 
P
S
 
G
V
 
L
I
 
A
K
 
H
E
 
D
I
 
I
G
 
F
A
 
N
V
 
H
I
 
V
K
 
L
Q
 
E
L
 
L
A
 
K
A
 
A
R
 
K
G
 
G
D
 
-
M
 
I
A
 
T
I
 
F
L
 
L
L
 
I
V
 
I
E
 
E
Q
 
H
F
 
R
Y
 
L
D
 
D
F
 
I
A
 
V
A
 
L
E
 
N
L
 
Y
A
 
I
D
 
D
Q
 
H
Y
 
L
L
 
Y
V
 
V
M
 
M
S
 
F
R
 
N
G
 
G
E
 
Q
I
 
I
V
 
I
Q
 
A
Q
 
E
G
 
G
R
 
R
G
 
G
E
 
E

4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
35% identity, 94% coverage: 1:219/232 of query aligns to 1:221/240 of 4ymuJ

query
sites
4ymuJ
M
 
M
L
 
I
Q
 
F
V
 
V
D
 
N
T
 
D
L
 
V
H
 
Y
Q
 
K
Y
 
N
Y
x
F
G
 
G
G
 
S
S
 
L
H
 
E
I
x
V
L
 
L
R
 
K
G
 
G
L
 
V
T
 
T
F
 
L
E
 
K
V
 
V
K
 
N
V
 
K
G
 
G
E
 
E
V
 
V
T
 
V
C
 
V
L
 
I
L
 
I
G
 
G
R
 
P
N
x
S
G
|
G
V
x
S
G
|
G
K
|
K
T
x
S
T
|
T
L
 
L
L
 
L
K
 
R
C
 
C
L
 
I
M
 
N
G
 
L
L
 
L
L
 
E
P
 
E
A
 
P
K
 
T
E
 
K
G
 
G
A
 
E
V
 
V
N
 
F
W
 
I
E
 
D
G
 
G
K
 
V
P
 
K
I
 
I
T
 
N
T
 
N
F
 
G
K
 
K
P
 
V
H
 
N
-
 
I
Q
 
N
R
 
K
V
 
V
H
 
R
A
 
Q
G
 
K
I
 
V
A
 
G
Y
 
M
V
 
V
P
 
F
Q
 
Q
G
 
H
R
 
F
E
 
N
I
 
L
F
 
F
G
 
P
R
 
H
L
 
L
T
 
T
V
 
A
E
 
I
E
 
E
N
 
N
L
 
I
L
 
T
M
 
L
G
 
A
L
 
P
S
 
V
R
 
K
F
 
V
P
 
K
G
 
K
S
 
M
E
 
N
A
 
K
K
 
K
E
 
E
V
 
A
P
 
E
A
 
E
F
 
L
I
 
A
Y
 
V
E
 
D
L
 
L
F
 
L
P
 
A
V
 
K
-
 
V
-
 
G
L
 
L
L
 
L
Q
 
D
M
 
K
K
 
K
Q
 
D
R
 
Q
R
 
Y
G
 
P
G
 
I
D
 
K
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
Q
Q
 
K
Q
 
Q
Q
 
R
L
 
L
A
 
A
I
 
I
G
 
A
R
 
R
A
 
A
L
 
L
A
 
A
S
 
M
R
 
Q
P
 
P
R
 
E
L
 
V
L
 
M
I
 
L
L
 
F
D
 
D
E
|
E
P
 
P
T
 
T
E
 
S
G
 
A
I
 
L
Q
 
D
P
 
P
S
 
E
V
 
M
I
 
V
K
 
K
E
 
E
I
 
V
G
 
L
A
 
N
V
 
V
I
 
M
K
 
K
Q
 
Q
L
 
L
A
 
A
A
 
N
R
 
E
G
 
G
D
 
-
M
 
M
A
 
T
I
 
M
L
 
V
L
 
V
V
 
V
E
 
T
Q
x
H
F
 
E
Y
 
M
D
 
G
F
 
F
A
 
A
A
 
R
E
 
E
L
 
V
A
 
G
D
 
D
Q
 
R
Y
 
V
L
 
I
V
 
F
M
 
M
S
 
D
R
 
D
G
 
G
E
 
V
I
 
I
V
 
V
Q
 
E
Q
 
E
G
 
G
R
 
T
G
 
P
E
 
E

4u00A Crystal structure of ttha1159 in complex with adp (see paper)
33% identity, 95% coverage: 1:221/232 of query aligns to 2:223/241 of 4u00A

query
sites
4u00A
M
 
I
L
 
I
Q
 
R
V
 
I
D
 
R
T
 
N
L
 
L
H
 
H
Q
 
K
Y
 
W
Y
x
F
G
 
G
G
 
P
S
 
L
H
 
H
I
x
V
L
 
L
R
 
K
G
 
G
L
 
I
T
 
H
F
 
L
E
 
E
V
 
V
K
 
A
V
 
P
G
 
G
E
 
E
V
 
K
T
 
L
C
 
V
L
 
I
L
 
I
G
 
G
R
 
P
N
x
S
G
|
G
V
x
S
G
|
G
K
|
K
T
x
S
T
|
T
L
 
L
L
 
I
K
 
R
C
 
T
L
 
I
M
 
N
G
 
R
L
 
L
L
 
E
P
 
D
A
 
F
K
 
Q
E
 
E
G
 
G
A
 
E
V
 
V
N
 
V
W
 
V
E
 
D
G
 
G
K
 
L
P
 
S
I
 
V
T
 
K
T
 
D
F
 
D
K
 
R
P
 
A
H
 
L
Q
 
R
R
 
E
V
 
I
H
 
R
A
 
R
G
 
E
I
 
V
A
 
G
Y
 
M
V
 
V
P
 
F
Q
 
Q
G
 
Q
R
 
F
E
 
N
I
 
L
F
 
F
G
 
P
R
 
H
L
 
M
T
 
T
V
 
V
E
 
L
E
 
E
N
 
N
L
 
V
L
 
T
-
 
L
-
 
A
-
 
P
M
 
M
G
 
R
L
 
V
S
 
R
R
 
R
F
 
W
P
 
P
G
 
R
S
 
E
E
 
K
A
 
A
K
 
E
E
 
K
V
 
K
P
 
A
A
 
L
F
 
E
I
 
L
Y
 
L
E
 
E
L
 
R
F
 
V
P
 
G
V
 
I
L
 
L
L
 
D
Q
 
Q
M
 
A
K
 
R
Q
 
-
R
 
K
R
 
Y
G
 
P
G
 
A
D
 
Q
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
Q
Q
 
Q
Q
 
Q
Q
 
R
L
 
V
A
 
A
I
 
I
G
 
A
R
 
R
A
 
A
L
 
L
A
 
A
S
 
M
R
 
E
P
 
P
R
 
K
L
 
I
L
 
M
I
 
L
L
 
F
D
 
D
E
 
E
P
 
P
T
 
T
E
 
S
G
 
A
I
 
L
Q
 
D
P
 
P
S
 
E
V
 
M
I
 
V
K
 
G
E
 
E
I
 
V
G
 
L
A
 
D
V
 
V
I
 
M
K
 
R
Q
 
D
L
 
L
A
 
-
A
 
A
R
 
Q
G
 
G
D
 
G
M
 
M
A
 
T
I
 
M
L
 
V
L
 
V
V
 
V
E
 
T
Q
 
H
F
 
E
Y
 
M
D
 
G
F
 
F
A
 
A
A
 
R
E
 
E
L
 
V
A
 
A
D
 
D
Q
 
R
Y
 
V
L
 
V
V
 
F
M
 
M
S
 
D
R
 
G
G
 
G
E
 
Q
I
 
I
V
 
V
Q
 
E
Q
 
E
G
 
G
R
 
R
G
 
P
E
 
E
N
 
E
M
 
I

3c4jA Abc protein artp in complex with atp-gamma-s
33% identity, 95% coverage: 1:221/232 of query aligns to 3:225/242 of 3c4jA

query
sites
3c4jA
M
 
M
L
 
I
Q
 
D
V
 
V
D
 
H
T
 
Q
L
 
L
H
 
K
Q
 
K
Y
 
S
Y
x
F
G
 
G
G
 
S
S
 
L
H
 
E
I
x
V
L
 
L
R
 
K
G
 
G
L
 
I
T
 
N
F
 
V
E
 
H
V
 
I
K
 
R
V
 
E
G
 
G
E
 
E
V
 
V
T
 
V
C
 
V
L
 
V
L
 
I
G
 
G
R
 
P
N
x
S
G
|
G
V
x
S
G
|
G
K
|
K
T
x
S
T
|
T
L
 
F
L
 
L
K
 
R
C
 
C
L
 
L
M
 
N
G
 
L
L
 
L
L
 
E
P
 
D
A
 
F
K
 
D
E
 
E
G
 
G
A
 
E
V
 
I
N
 
I
W
 
I
E
 
D
G
 
G
K
 
I
P
 
N
I
 
L
T
 
K
T
 
A
F
 
K
K
 
D
P
 
T
H
 
N
-
 
L
Q
 
N
R
 
K
V
 
V
H
 
R
A
 
E
G
 
E
I
 
V
A
 
G
Y
 
M
V
 
V
P
 
F
Q
 
Q
G
 
R
R
 
F
E
 
N
I
 
L
F
 
F
G
 
P
R
 
H
L
 
M
T
 
T
V
 
V
E
 
L
E
 
N
N
 
N
L
 
I
L
 
T
-
 
L
-
 
A
-
 
P
M
 
M
G
 
K
L
 
V
S
 
R
R
 
K
F
 
W
P
 
P
G
 
R
S
 
E
E
 
K
A
 
A
K
 
E
E
 
-
V
 
-
P
 
-
A
 
A
F
 
K
I
 
A
Y
 
M
E
 
E
L
 
L
F
 
L
P
 
D
-
 
K
V
 
V
L
 
G
L
 
L
Q
 
K
M
 
D
K
 
K
Q
 
A
R
 
H
R
 
A
G
 
Y
G
 
P
D
 
D
-
 
S
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
Q
Q
 
A
Q
 
Q
Q
 
R
L
 
V
A
 
A
I
 
I
G
 
A
R
 
R
A
 
A
L
 
L
A
 
A
S
 
M
R
 
E
P
 
P
R
 
K
L
 
I
L
 
M
I
 
L
L
 
F
D
 
D
E
 
E
P
 
P
T
 
T
E
 
S
G
 
A
I
 
L
Q
 
D
P
 
P
S
 
E
V
 
M
I
 
V
K
 
G
E
 
E
I
 
V
G
 
L
A
 
S
V
 
V
I
 
M
K
 
K
Q
 
Q
L
 
L
A
 
A
A
 
N
R
 
E
G
 
G
D
 
-
M
 
M
A
 
T
I
 
M
L
 
V
L
 
V
V
 
V
E
 
T
Q
 
H
F
 
E
Y
 
M
D
 
G
F
 
F
A
 
A
A
 
R
E
 
E
L
 
V
A
 
G
D
 
D
Q
 
R
Y
 
V
L
 
L
V
 
F
M
 
M
S
 
D
R
 
G
G
 
G
E
 
Y
I
 
I
V
 
I
Q
 
E
Q
 
E
G
 
G
R
 
K
G
 
P
E
 
E
N
 
D
M
 
L

3c41J Abc protein artp in complex with amp-pnp/mg2+
33% identity, 95% coverage: 1:221/232 of query aligns to 3:225/242 of 3c41J

query
sites
3c41J
M
 
M
L
 
I
Q
 
D
V
 
V
D
 
H
T
 
Q
L
 
L
H
 
K
Q
 
K
Y
 
S
Y
x
F
G
 
G
G
 
S
S
 
L
H
 
E
I
x
V
L
 
L
R
 
K
G
 
G
L
 
I
T
 
N
F
 
V
E
 
H
V
 
I
K
 
R
V
 
E
G
 
G
E
 
E
V
 
V
T
 
V
C
 
V
L
 
V
L
 
I
G
 
G
R
 
P
N
x
S
G
|
G
V
 
S
G
|
G
K
|
K
T
x
S
T
|
T
L
 
F
L
 
L
K
 
R
C
 
C
L
 
L
M
 
N
G
 
L
L
 
L
L
 
E
P
 
D
A
 
F
K
 
D
E
 
E
G
 
G
A
 
E
V
 
I
N
 
I
W
 
I
E
 
D
G
 
G
K
 
I
P
 
N
I
 
L
T
 
K
T
 
A
F
 
K
K
 
D
P
 
T
H
 
N
-
 
L
Q
 
N
R
 
K
V
 
V
H
 
R
A
 
E
G
 
E
I
 
V
A
 
G
Y
 
M
V
 
V
P
 
F
Q
 
Q
G
 
R
R
 
F
E
 
N
I
 
L
F
 
F
G
 
P
R
 
H
L
 
M
T
 
T
V
 
V
E
 
L
E
 
N
N
 
N
L
 
I
L
 
T
-
 
L
-
 
A
-
 
P
M
 
M
G
 
K
L
 
V
S
 
R
R
 
K
F
 
W
P
 
P
G
 
R
S
 
E
E
 
K
A
 
A
K
 
E
E
 
-
V
 
-
P
 
-
A
 
A
F
 
K
I
 
A
Y
 
M
E
 
E
L
 
L
F
 
L
P
 
D
-
 
K
V
 
V
L
 
G
L
 
L
Q
 
K
M
 
D
K
 
K
Q
 
A
R
 
H
R
 
A
G
 
Y
G
 
P
D
 
D
-
 
S
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
Q
Q
 
A
Q
 
Q
Q
 
R
L
 
V
A
 
A
I
 
I
G
 
A
R
 
R
A
 
A
L
 
L
A
 
A
S
 
M
R
 
E
P
 
P
R
 
K
L
 
I
L
 
M
I
 
L
L
 
F
D
|
D
E
 
E
P
 
P
T
 
T
E
 
S
G
 
A
I
 
L
Q
 
D
P
 
P
S
 
E
V
 
M
I
 
V
K
 
G
E
 
E
I
 
V
G
 
L
A
 
S
V
 
V
I
 
M
K
 
K
Q
 
Q
L
 
L
A
 
A
A
 
N
R
 
E
G
 
G
D
 
-
M
 
M
A
 
T
I
 
M
L
 
V
L
 
V
V
 
V
E
 
T
Q
 
H
F
 
E
Y
 
M
D
 
G
F
 
F
A
 
A
A
 
R
E
 
E
L
 
V
A
 
G
D
 
D
Q
 
R
Y
 
V
L
 
L
V
 
F
M
 
M
S
 
D
R
 
G
G
 
G
E
 
Y
I
 
I
V
 
I
Q
 
E
Q
 
E
G
 
G
R
 
K
G
 
P
E
 
E
N
 
D
M
 
L

2olkA Abc protein artp in complex with adp-beta-s
33% identity, 95% coverage: 1:221/232 of query aligns to 3:225/242 of 2olkA

query
sites
2olkA
M
 
M
L
 
I
Q
 
D
V
 
V
D
 
H
T
 
Q
L
 
L
H
 
K
Q
 
K
Y
 
S
Y
x
F
G
 
G
G
 
S
S
 
L
H
 
E
I
x
V
L
 
L
R
 
K
G
 
G
L
 
I
T
 
N
F
 
V
E
 
H
V
 
I
K
 
R
V
 
E
G
 
G
E
 
E
V
 
V
T
 
V
C
 
V
L
 
V
L
 
I
G
 
G
R
 
P
N
x
S
G
|
G
V
x
S
G
|
G
K
|
K
T
x
S
T
|
T
L
 
F
L
 
L
K
 
R
C
 
C
L
 
L
M
 
N
G
 
L
L
 
L
L
 
E
P
 
D
A
 
F
K
 
D
E
 
E
G
 
G
A
 
E
V
 
I
N
 
I
W
 
I
E
 
D
G
 
G
K
 
I
P
 
N
I
 
L
T
 
K
T
 
A
F
 
K
K
 
D
P
 
T
H
 
N
-
 
L
Q
 
N
R
 
K
V
 
V
H
 
R
A
 
E
G
 
E
I
 
V
A
 
G
Y
 
M
V
 
V
P
 
F
Q
 
Q
G
 
R
R
 
F
E
 
N
I
 
L
F
 
F
G
 
P
R
 
H
L
 
M
T
 
T
V
 
V
E
 
L
E
 
N
N
 
N
L
 
I
L
 
T
-
 
L
-
 
A
-
 
P
M
 
M
G
 
K
L
 
V
S
 
R
R
 
K
F
 
W
P
 
P
G
 
R
S
 
E
E
 
K
A
 
A
K
 
E
E
 
-
V
 
-
P
 
-
A
 
A
F
 
K
I
 
A
Y
 
M
E
 
E
L
 
L
F
 
L
P
 
D
-
 
K
V
 
V
L
 
G
L
 
L
Q
 
K
M
 
D
K
 
K
Q
 
A
R
 
H
R
 
A
G
 
Y
G
 
P
D
 
D
-
 
S
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
Q
Q
 
A
Q
 
Q
Q
 
R
L
 
V
A
 
A
I
 
I
G
 
A
R
 
R
A
 
A
L
 
L
A
 
A
S
 
M
R
 
E
P
 
P
R
 
K
L
 
I
L
 
M
I
 
L
L
 
F
D
 
D
E
 
E
P
 
P
T
 
T
E
 
S
G
 
A
I
 
L
Q
 
D
P
 
P
S
 
E
V
 
M
I
 
V
K
 
G
E
 
E
I
 
V
G
 
L
A
 
S
V
 
V
I
 
M
K
 
K
Q
 
Q
L
 
L
A
 
A
A
 
N
R
 
E
G
 
G
D
 
-
M
 
M
A
 
T
I
 
M
L
 
V
L
 
V
V
 
V
E
 
T
Q
 
H
F
 
E
Y
 
M
D
 
G
F
 
F
A
 
A
A
 
R
E
 
E
L
 
V
A
 
G
D
 
D
Q
 
R
Y
 
V
L
 
L
V
 
F
M
 
M
S
 
D
R
 
G
G
 
G
E
 
Y
I
 
I
V
 
I
Q
 
E
Q
 
E
G
 
G
R
 
K
G
 
P
E
 
E
N
 
D
M
 
L

2oljA Abc protein artp in complex with adp/mg2+
33% identity, 95% coverage: 1:221/232 of query aligns to 3:225/242 of 2oljA

query
sites
2oljA
M
 
M
L
 
I
Q
 
D
V
 
V
D
 
H
T
 
Q
L
 
L
H
 
K
Q
 
K
Y
 
S
Y
x
F
G
 
G
G
 
S
S
 
L
H
 
E
I
x
V
L
 
L
R
 
K
G
 
G
L
 
I
T
 
N
F
 
V
E
 
H
V
 
I
K
 
R
V
 
E
G
 
G
E
 
E
V
 
V
T
 
V
C
 
V
L
 
V
L
 
I
G
 
G
R
 
P
N
x
S
G
|
G
V
x
S
G
|
G
K
|
K
T
x
S
T
|
T
L
 
F
L
 
L
K
 
R
C
 
C
L
 
L
M
 
N
G
 
L
L
 
L
L
 
E
P
 
D
A
 
F
K
 
D
E
 
E
G
 
G
A
 
E
V
 
I
N
 
I
W
 
I
E
 
D
G
 
G
K
 
I
P
 
N
I
 
L
T
 
K
T
 
A
F
 
K
K
 
D
P
 
T
H
 
N
-
 
L
Q
 
N
R
 
K
V
 
V
H
 
R
A
 
E
G
 
E
I
 
V
A
 
G
Y
 
M
V
 
V
P
 
F
Q
 
Q
G
 
R
R
 
F
E
 
N
I
 
L
F
 
F
G
 
P
R
 
H
L
 
M
T
 
T
V
 
V
E
 
L
E
 
N
N
 
N
L
 
I
L
 
T
-
 
L
-
 
A
-
 
P
M
 
M
G
 
K
L
 
V
S
 
R
R
 
K
F
 
W
P
 
P
G
 
R
S
 
E
E
 
K
A
 
A
K
 
E
E
 
-
V
 
-
P
 
-
A
 
A
F
 
K
I
 
A
Y
 
M
E
 
E
L
 
L
F
 
L
P
 
D
-
 
K
V
 
V
L
 
G
L
 
L
Q
 
K
M
 
D
K
 
K
Q
 
A
R
 
H
R
 
A
G
 
Y
G
 
P
D
 
D
-
 
S
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
Q
Q
 
A
Q
 
Q
Q
 
R
L
 
V
A
 
A
I
 
I
G
 
A
R
 
R
A
 
A
L
 
L
A
 
A
S
 
M
R
 
E
P
 
P
R
 
K
L
 
I
L
 
M
I
 
L
L
 
F
D
 
D
E
 
E
P
 
P
T
 
T
E
 
S
G
 
A
I
 
L
Q
 
D
P
 
P
S
 
E
V
 
M
I
 
V
K
 
G
E
 
E
I
 
V
G
 
L
A
 
S
V
 
V
I
 
M
K
 
K
Q
 
Q
L
 
L
A
 
A
A
 
N
R
 
E
G
 
G
D
 
-
M
 
M
A
 
T
I
 
M
L
 
V
L
 
V
V
 
V
E
 
T
Q
 
H
F
 
E
Y
 
M
D
 
G
F
 
F
A
 
A
A
 
R
E
 
E
L
 
V
A
 
G
D
 
D
Q
 
R
Y
 
V
L
 
L
V
 
F
M
 
M
S
 
D
R
 
G
G
 
G
E
 
Y
I
 
I
V
 
I
Q
 
E
Q
 
E
G
 
G
R
 
K
G
 
P
E
 
E
N
 
D
M
 
L

6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
27% identity, 95% coverage: 1:221/232 of query aligns to 2:223/240 of 6mjpA

query
sites
6mjpA
M
 
I
L
 
L
Q
 
K
V
 
A
D
 
Q
T
 
H
L
 
L
H
 
A
Q
 
K
Y
 
S
Y
 
Y
G
 
K
G
 
K
S
 
R
H
 
K
I
 
V
L
 
V
R
 
S
G
 
D
L
 
V
T
 
S
F
 
L
E
 
Q
V
 
V
K
 
E
V
 
S
G
 
G
E
 
Q
V
 
I
T
 
V
C
 
G
L
 
L
L
 
L
G
 
G
R
 
P
N
 
N
G
 
G
V
 
A
G
 
G
K
 
K
T
 
T
T
 
T
L
 
S
L
 
F
K
 
Y
C
 
M
L
 
I
M
 
V
G
 
G
L
 
L
L
 
V
P
 
A
A
 
R
K
 
D
E
 
E
G
 
G
A
 
T
V
 
I
N
 
T
W
 
I
E
 
D
G
 
D
K
 
N
P
 
D
I
 
I
T
 
S
T
 
I
F
 
L
K
 
P
P
 
M
H
 
H
Q
 
S
R
 
R
V
 
S
H
 
R
A
 
M
G
 
G
I
 
I
A
 
G
Y
 
Y
V
 
L
P
 
P
Q
 
Q
G
 
E
R
 
A
E
 
S
I
 
I
F
 
F
G
 
R
R
 
K
L
 
L
T
 
S
V
 
V
E
 
E
E
 
D
N
 
N
L
 
I
L
 
M
M
 
A
G
 
V
L
 
L
-
 
Q
-
 
T
-
 
R
S
 
E
R
 
E
F
 
L
P
 
T
G
 
H
S
x
E
E
 
E
A
 
R
K
 
Q
E
x
D
V
 
K
P
 
L
A
 
E
F
 
D
I
 
L
Y
 
L
E
 
E
L
 
E
F
 
F
P
 
H
V
 
I
L
 
-
L
 
Q
Q
 
H
M
 
I
K
 
R
Q
 
K
R
 
S
R
 
A
G
 
G
G
 
M
D
 
A
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
E
Q
 
R
Q
 
R
Q
 
R
L
 
V
A
 
E
I
 
I
G
 
A
R
 
R
A
 
A
L
 
L
A
 
A
S
 
A
R
 
N
P
 
P
R
 
Q
L
 
F
L
 
I
I
 
L
L
 
L
D
 
D
E
 
Q
P
 
P
T
 
F
E
 
A
G
 
G
I
 
V
Q
 
D
P
 
P
S
 
I
V
 
S
I
 
V
K
 
I
E
 
D
I
 
I
G
 
K
A
 
K
V
 
I
I
 
I
K
 
E
Q
 
H
L
 
L
A
 
R
A
 
D
R
 
R
G
 
G
D
 
-
M
 
L
A
 
G
I
 
V
L
 
L
L
 
I
V
 
T
E
 
D
Q
 
H
F
 
N
Y
 
V
D
 
R
F
 
E
A
 
T
A
 
L
E
 
D
L
 
V
A
 
C
D
 
E
Q
 
K
Y
 
A
L
 
Y
V
 
I
M
 
V
S
 
S
R
 
Q
G
 
G
E
 
R
I
 
L
V
 
I
Q
 
A
Q
 
E
G
 
G
R
 
T
G
 
P
E
 
Q
N
 
D
M
 
V

6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
28% identity, 93% coverage: 2:216/232 of query aligns to 3:218/235 of 6mhzA

query
sites
6mhzA
L
 
L
Q
 
T
V
 
A
D
 
K
T
 
N
L
 
L
H
 
A
Q
 
K
Y
 
A
Y
|
Y
G
 
K
G
 
G
S
 
R
H
 
R
I
 
V
L
 
V
R
 
E
G
 
D
L
 
V
T
 
S
F
 
L
E
 
T
V
 
V
K
 
N
V
 
S
G
 
G
E
 
E
V
 
I
T
 
V
C
 
G
L
 
L
L
 
L
G
 
G
R
 
P
N
|
N
G
|
G
V
 
A
G
|
G
K
|
K
T
|
T
T
|
T
L
 
T
L
 
F
K
 
Y
C
 
M
L
 
V
M
 
V
G
 
G
L
 
I
L
 
V
P
 
P
A
 
R
K
 
D
E
 
A
G
 
G
A
 
N
V
 
I
N
 
I
W
 
I
E
 
D
G
 
D
K
 
D
P
 
D
I
 
I
T
 
S
T
 
L
F
 
L
K
 
P
P
 
L
H
 
H
Q
 
A
R
 
R
V
 
A
H
 
R
A
 
R
G
 
G
I
 
I
A
 
G
Y
 
Y
V
 
L
P
 
P
Q
|
Q
G
 
E
R
 
A
E
 
S
I
 
I
F
 
F
G
 
R
R
 
R
L
 
L
T
 
S
V
 
V
E
 
Y
E
 
D
N
 
N
L
 
L
L
 
M
M
 
A
G
 
V
L
 
L
-
 
Q
-
 
I
-
 
R
S
 
D
R
 
D
F
 
L
P
 
S
G
 
A
S
 
E
E
 
Q
A
 
R
K
 
E
E
 
D
V
 
R
P
 
A
A
 
N
F
 
E
I
 
L
Y
 
M
E
 
E
L
 
E
F
 
F
P
 
H
V
 
I
L
 
-
L
 
E
Q
 
H
M
 
L
K
 
R
Q
 
D
R
 
S
R
 
M
G
 
G
G
 
Q
D
x
S
L
 
L
S
|
S
G
|
G
G
|
G
Q
 
E
Q
 
R
Q
 
R
Q
 
R
L
 
V
A
 
E
I
 
I
G
 
A
R
 
R
A
 
A
L
 
L
A
 
A
S
 
A
R
 
N
P
 
P
R
 
K
L
 
F
L
 
I
I
 
L
L
 
L
D
 
D
E
|
E
P
 
P
T
 
F
E
 
A
G
|
G
I
 
V
Q
 
D
P
 
P
S
 
I
V
 
S
I
 
V
K
 
I
E
 
D
I
 
I
G
 
K
A
 
R
V
 
I
I
 
I
K
 
E
Q
 
H
L
 
L
A
 
R
A
 
D
R
 
S
G
 
G
D
 
-
M
 
L
A
 
G
I
 
V
L
 
L
L
 
I
V
 
T
E
 
D
Q
x
H
F
 
N
Y
 
V
D
 
R
F
 
E
A
 
T
A
 
L
E
 
A
L
 
V
A
 
C
D
 
E
Q
 
R
Y
 
A
L
 
Y
V
 
I
M
 
V
S
 
S
R
 
Q
G
 
G
E
 
H
I
 
L
V
 
I
Q
 
A
Q
 
H
G
 
G

P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
35% identity, 84% coverage: 17:212/232 of query aligns to 268:473/501 of P04983

query
sites
P04983
L
 
V
R
 
N
G
 
D
L
 
V
T
 
S
F
 
F
E
 
T
V
 
L
K
 
R
V
 
K
G
 
G
E
 
E
V
 
I
T
 
L
C
 
G
L
 
V
L
 
S
G
 
G
R
 
L
N
 
M
G
 
G
V
 
A
G
 
G
K
 
R
T
 
T
T
 
E
L
 
L
L
 
M
K
 
K
C
 
V
L
 
L
M
 
Y
G
 
G
L
 
A
L
 
L
P
 
P
A
 
R
K
 
T
E
 
S
G
 
G
A
 
Y
V
 
V
N
 
T
W
 
L
E
 
D
G
 
G
K
 
H
P
 
E
I
 
V
T
 
V
T
 
T
F
 
R
K
 
S
P
 
P
H
 
Q
Q
 
D
R
 
G
V
 
L
H
 
A
A
 
N
G
 
G
I
 
I
A
 
V
Y
 
Y
V
 
I
P
 
S
Q
 
E
G
 
D
R
 
R
E
 
K
I
 
R
F
 
D
G
 
G
R
 
L
-
 
V
-
 
L
-
 
G
L
 
M
T
 
S
V
 
V
E
 
K
E
 
E
N
 
N
L
 
M
-
 
S
-
 
L
-
 
T
-
 
A
L
 
L
M
 
R
G
 
Y
L
 
F
S
 
S
R
 
R
F
 
A
P
 
G
G
 
G
S
 
S
-
 
L
-
 
K
-
 
H
-
 
A
-
 
D
E
 
E
A
 
Q
K
 
Q
E
 
A
V
 
V
P
 
S
A
 
D
F
 
F
I
 
I
Y
 
-
E
 
R
L
 
L
F
 
F
P
 
N
V
 
V
L
 
K
L
 
T
Q
 
P
M
 
S
K
 
M
Q
 
E
R
 
Q
R
 
A
G
 
I
G
 
G
D
 
L
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
N
Q
 
Q
Q
 
Q
Q
 
K
L
 
V
A
 
A
I
 
I
G
 
A
R
 
R
A
 
G
L
 
L
A
 
M
S
 
T
R
 
R
P
 
P
R
 
K
L
 
V
L
 
L
I
 
I
L
 
L
D
 
D
E
 
E
P
 
P
T
 
T
E
 
R
G
 
G
I
 
V
Q
 
D
P
 
V
S
 
G
V
 
A
I
 
K
K
 
K
E
 
E
I
 
I
G
 
Y
A
 
Q
V
 
L
I
 
I
K
 
N
Q
 
Q
L
 
F
A
 
K
A
 
A
R
 
D
G
 
G
D
 
-
M
 
L
A
 
S
I
 
I
L
 
I
L
 
L
V
 
V
E
 
S
Q
 
S
F
 
E
Y
 
M
D
 
P
F
 
E
A
 
V
A
 
L
E
 
G
L
 
M
A
 
S
D
 
D
Q
 
R
Y
 
I
L
 
I
V
 
V
M
 
M
S
 
H
R
 
E
G
 
G
E
 
H
I
 
L

Sites not aligning to the query:

6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
28% identity, 93% coverage: 2:216/232 of query aligns to 3:218/238 of 6s8nB

query
sites
6s8nB
L
 
L
Q
 
T
V
 
A
D
 
K
T
 
N
L
 
L
H
 
A
Q
 
K
Y
 
A
Y
 
Y
G
 
K
G
 
G
S
 
R
H
 
R
I
 
V
L
 
V
R
 
E
G
 
D
L
 
V
T
 
S
F
 
L
E
 
T
V
 
V
K
 
N
V
 
S
G
 
G
E
 
E
V
 
I
T
 
V
C
 
G
L
 
L
L
 
L
G
 
G
R
 
P
N
 
N
G
 
G
V
 
A
G
 
G
K
 
K
T
 
T
T
 
T
L
 
T
L
 
F
K
 
Y
C
 
M
L
 
V
M
 
V
G
 
G
L
 
I
L
 
V
P
 
P
A
 
R
K
 
D
E
 
A
G
 
G
A
 
N
V
 
I
N
 
I
W
 
I
E
 
D
G
 
D
K
 
D
P
 
D
I
 
I
T
 
S
T
 
L
F
 
L
K
 
P
P
 
L
H
 
H
Q
 
A
R
 
R
V
 
A
H
 
R
A
 
R
G
 
G
I
 
I
A
 
G
Y
 
Y
V
 
L
P
 
P
Q
 
Q
G
 
E
R
 
A
E
 
S
I
 
I
F
 
F
G
x
R
R
 
R
L
 
L
T
 
S
V
 
V
E
 
Y
E
 
D
N
 
N
L
 
L
L
 
M
M
 
A
G
 
V
L
 
L
-
 
Q
-
 
I
-
 
R
S
 
D
R
 
D
F
 
L
P
 
S
G
 
A
S
 
E
E
 
Q
A
 
R
K
 
E
E
 
D
V
 
R
P
 
A
A
 
N
F
 
E
I
 
L
Y
 
M
E
 
E
L
 
E
F
 
F
P
 
H
V
 
I
L
 
-
L
 
E
Q
 
H
M
 
L
K
 
R
Q
 
D
R
 
S
R
x
M
G
|
G
G
x
Q
D
 
S
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
E
Q
 
R
Q
 
R
Q
 
R
L
 
V
A
 
E
I
 
I
G
 
A
R
 
R
A
 
A
L
 
L
A
 
A
S
 
A
R
 
N
P
 
P
R
 
K
L
 
F
L
 
I
I
 
L
L
 
L
D
 
D
E
 
E
P
 
P
T
 
F
E
 
A
G
 
G
I
 
V
Q
 
D
P
 
P
S
 
I
V
 
S
I
 
V
K
 
I
E
 
D
I
 
I
G
 
K
A
 
R
V
 
I
I
 
I
K
 
E
Q
 
H
L
 
L
A
 
R
A
 
D
R
 
S
G
 
G
D
 
-
M
 
L
A
 
G
I
 
V
L
 
L
L
 
I
V
 
T
E
 
D
Q
 
H
F
 
N
Y
 
V
D
 
R
F
 
E
A
 
T
A
 
L
E
 
A
L
 
V
A
 
C
D
 
E
Q
 
R
Y
 
A
L
 
Y
V
 
I
M
 
V
S
 
S
R
 
Q
G
 
G
E
 
H
I
 
L
V
 
I
Q
 
A
Q
 
H
G
 
G

6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
28% identity, 93% coverage: 2:216/232 of query aligns to 3:218/238 of 6s8gA

query
sites
6s8gA
L
 
L
Q
 
T
V
 
A
D
 
K
T
 
N
L
 
L
H
 
A
Q
 
K
Y
 
A
Y
|
Y
G
 
K
G
 
G
S
x
R
H
 
R
I
 
V
L
 
V
R
 
E
G
 
D
L
 
V
T
 
S
F
 
L
E
 
T
V
 
V
K
 
N
V
 
S
G
 
G
E
 
E
V
 
I
T
 
V
C
 
G
L
 
L
L
 
L
G
 
G
R
 
P
N
|
N
G
 
G
V
 
A
G
|
G
K
|
K
T
|
T
T
|
T
L
 
T
L
 
F
K
 
Y
C
 
M
L
 
V
M
 
V
G
 
G
L
 
I
L
 
V
P
 
P
A
 
R
K
 
D
E
 
A
G
 
G
A
 
N
V
 
I
N
 
I
W
 
I
E
 
D
G
 
D
K
 
D
P
 
D
I
 
I
T
 
S
T
 
L
F
 
L
K
 
P
P
 
L
H
 
H
Q
 
A
R
 
R
V
 
A
H
 
R
A
 
R
G
 
G
I
 
I
A
 
G
Y
 
Y
V
 
L
P
 
P
Q
|
Q
G
 
E
R
 
A
E
 
S
I
 
I
F
 
F
G
 
R
R
 
R
L
 
L
T
 
S
V
 
V
E
 
Y
E
 
D
N
 
N
L
 
L
L
 
M
M
 
A
G
 
V
L
 
L
-
 
Q
-
 
I
-
 
R
S
 
D
R
 
D
F
 
L
P
 
S
G
 
A
S
 
E
E
 
Q
A
 
R
K
 
E
E
 
D
V
 
R
P
 
A
A
 
N
F
 
E
I
 
L
Y
 
M
E
 
E
L
 
E
F
 
F
P
 
H
V
 
I
L
 
-
L
 
E
Q
 
H
M
 
L
K
 
R
Q
 
D
R
 
S
R
 
M
G
 
G
G
 
Q
D
x
S
L
 
L
S
|
S
G
 
G
G
 
G
Q
x
E
Q
 
R
Q
 
R
Q
 
R
L
 
V
A
 
E
I
 
I
G
 
A
R
 
R
A
 
A
L
 
L
A
 
A
S
 
A
R
 
N
P
 
P
R
 
K
L
 
F
L
 
I
I
 
L
L
 
L
D
 
D
E
 
E
P
 
P
T
 
F
E
 
A
G
 
G
I
 
V
Q
 
D
P
 
P
S
 
I
V
 
S
I
 
V
K
 
I
E
 
D
I
 
I
G
 
K
A
 
R
V
 
I
I
 
I
K
 
E
Q
 
H
L
 
L
A
 
R
A
 
D
R
 
S
G
 
G
D
 
-
M
 
L
A
 
G
I
 
V
L
 
L
L
 
I
V
 
T
E
 
D
Q
 
H
F
 
N
Y
 
V
D
 
R
F
 
E
A
 
T
A
 
L
E
 
A
L
 
V
A
 
C
D
 
E
Q
 
R
Y
 
A
L
 
Y
V
 
I
M
 
V
S
 
S
R
 
Q
G
 
G
E
 
H
I
 
L
V
 
I
Q
 
A
Q
 
H
G
 
G

6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
28% identity, 93% coverage: 2:216/232 of query aligns to 3:218/234 of 6b89A

query
sites
6b89A
L
 
L
Q
 
T
V
 
A
D
 
K
T
 
N
L
 
L
H
 
A
Q
 
K
Y
 
A
Y
|
Y
G
 
K
G
 
G
S
x
R
H
 
R
I
x
V
L
 
V
R
 
E
G
 
D
L
 
V
T
 
S
F
 
L
E
 
T
V
 
V
K
 
N
V
 
S
G
 
G
E
 
E
V
 
I
T
 
V
C
 
G
L
 
L
L
 
L
G
 
G
R
 
P
N
|
N
G
|
G
V
 
A
G
|
G
K
|
K
T
|
T
T
|
T
L
 
T
L
 
F
K
 
Y
C
 
M
L
 
V
M
 
V
G
 
G
L
 
I
L
 
V
P
 
P
A
 
R
K
 
D
E
 
A
G
 
G
A
 
N
V
 
I
N
 
I
W
 
I
E
 
D
G
 
D
K
 
D
P
 
D
I
 
I
T
 
S
T
 
L
F
 
L
K
 
P
P
x
L
H
|
H
Q
 
A
R
 
R
V
 
A
H
 
R
A
 
R
G
 
G
I
 
I
A
 
G
Y
 
Y
V
 
L
P
|
P
Q
|
Q
G
 
E
R
x
A
E
x
S
I
 
I
F
|
F
G
x
R
R
|
R
L
|
L
T
 
S
V
 
V
E
 
Y
E
 
D
N
 
N
L
 
L
L
 
M
M
 
A
G
x
V
L
 
L
-
 
Q
-
 
I
-
 
R
S
 
D
R
 
D
F
 
L
P
 
S
G
 
A
S
 
E
E
 
Q
A
 
R
K
 
E
E
 
D
V
 
R
P
 
A
A
 
N
F
 
E
I
 
L
Y
 
M
E
 
E
L
 
E
F
 
F
P
 
H
V
 
I
L
 
-
L
 
E
Q
 
H
M
 
L
K
 
R
Q
 
D
R
 
S
R
 
M
G
 
G
G
x
Q
D
 
S
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
E
Q
 
R
Q
 
R
Q
 
R
L
 
V
A
 
E
I
 
I
G
 
A
R
|
R
A
 
A
L
 
L
A
 
A
S
 
A
R
 
N
P
 
P
R
 
K
L
 
F
L
 
I
I
 
L
L
 
L
D
 
D
E
 
E
P
 
P
T
 
F
E
 
A
G
 
G
I
 
V
Q
 
D
P
 
P
S
 
I
V
 
S
I
 
V
K
 
I
E
 
D
I
 
I
G
 
K
A
 
R
V
 
I
I
 
I
K
 
E
Q
 
H
L
 
L
A
 
R
A
 
D
R
 
S
G
 
G
D
 
-
M
 
L
A
 
G
I
 
V
L
 
L
L
 
I
V
 
T
E
 
D
Q
 
H
F
 
N
Y
 
V
D
 
R
F
 
E
A
 
T
A
 
L
E
 
A
L
 
V
A
 
C
D
 
E
Q
 
R
Y
 
A
L
 
Y
V
 
I
M
 
V
S
 
S
R
 
Q
G
 
G
E
 
H
I
 
L
V
 
I
Q
 
A
Q
 
H
G
 
G

4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
28% identity, 93% coverage: 2:216/232 of query aligns to 3:218/234 of 4p31A

query
sites
4p31A
L
 
L
Q
 
T
V
 
A
D
 
K
T
 
N
L
 
L
H
 
A
Q
 
K
Y
 
A
Y
|
Y
G
 
K
G
 
G
S
x
R
H
 
R
I
x
V
L
 
V
R
 
E
G
 
D
L
 
V
T
 
S
F
 
L
E
 
T
V
 
V
K
 
N
V
 
S
G
 
G
E
 
E
V
 
I
T
 
V
C
 
G
L
 
L
L
 
L
G
 
G
R
 
P
N
 
N
G
|
G
V
 
A
G
|
G
K
|
K
T
|
T
T
|
T
L
 
T
L
 
F
K
 
Y
C
 
M
L
 
V
M
 
V
G
 
G
L
 
I
L
 
V
P
 
P
A
 
R
K
 
D
E
 
A
G
 
G
A
 
N
V
 
I
N
 
I
W
 
I
E
 
D
G
 
D
K
 
D
P
 
D
I
 
I
T
 
S
T
 
L
F
 
L
K
 
P
P
 
L
H
 
H
Q
 
A
R
 
R
V
 
A
H
 
R
A
 
R
G
 
G
I
 
I
A
 
G
Y
 
Y
V
 
L
P
 
P
Q
|
Q
G
 
E
R
 
A
E
 
S
I
 
I
F
 
F
G
 
R
R
 
R
L
 
L
T
 
S
V
 
V
E
 
Y
E
 
D
N
 
N
L
 
L
L
 
M
M
 
A
G
 
V
L
 
L
-
 
Q
-
 
I
-
 
R
S
 
D
R
 
D
F
 
L
P
 
S
G
 
A
S
 
E
E
 
Q
A
 
R
K
 
E
E
 
D
V
 
R
P
 
A
A
 
N
F
 
E
I
 
L
Y
 
M
E
 
E
L
 
E
F
 
F
P
 
H
V
 
I
L
 
-
L
 
E
Q
 
H
M
 
L
K
 
R
Q
 
D
R
 
S
R
 
M
G
 
G
G
 
Q
D
 
S
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
E
Q
 
R
Q
 
R
Q
 
R
L
 
V
A
 
E
I
 
I
G
 
A
R
 
R
A
 
A
L
 
L
A
 
A
S
 
A
R
 
N
P
 
P
R
 
K
L
 
F
L
 
I
I
 
L
L
 
L
D
 
D
E
 
E
P
 
P
T
 
F
E
 
A
G
 
G
I
 
V
Q
 
D
P
 
P
S
 
I
V
 
S
I
 
V
K
 
I
E
 
D
I
 
I
G
 
K
A
 
R
V
 
I
I
 
I
K
 
E
Q
 
H
L
 
L
A
 
R
A
 
D
R
 
S
G
 
G
D
 
-
M
 
L
A
 
G
I
 
V
L
 
L
L
 
I
V
 
T
E
 
D
Q
 
H
F
 
N
Y
 
V
D
 
R
F
 
E
A
 
T
A
 
L
E
 
A
L
 
V
A
 
C
D
 
E
Q
 
R
Y
 
A
L
 
Y
V
 
I
M
 
V
S
 
S
R
 
Q
G
 
G
E
 
H
I
 
L
V
 
I
Q
 
A
Q
 
H
G
 
G

6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
28% identity, 93% coverage: 2:216/232 of query aligns to 3:218/233 of 6b8bA

query
sites
6b8bA
L
 
L
Q
 
T
V
 
A
D
 
K
T
 
N
L
 
L
H
 
A
Q
 
K
Y
 
A
Y
|
Y
G
 
K
G
 
G
S
x
R
H
 
R
I
x
V
L
 
V
R
 
E
G
 
D
L
 
V
T
 
S
F
 
L
E
 
T
V
 
V
K
 
N
V
 
S
G
 
G
E
 
E
V
 
I
T
 
V
C
 
G
L
 
L
L
 
L
G
 
G
R
 
P
N
 
N
G
|
G
V
 
A
G
|
G
K
|
K
T
|
T
T
|
T
L
 
T
L
 
F
K
 
Y
C
 
M
L
 
V
M
 
V
G
 
G
L
 
I
L
 
V
P
 
P
A
 
R
K
 
D
E
 
A
G
 
G
A
 
N
V
 
I
N
 
I
W
 
I
E
 
D
G
 
D
K
 
D
P
 
D
I
 
I
T
 
S
T
 
L
F
 
L
K
 
P
P
 
L
H
 
H
Q
 
A
R
 
R
V
 
A
H
 
R
A
 
R
G
 
G
I
 
I
A
 
G
Y
 
Y
V
 
L
P
 
P
Q
 
Q
G
 
E
R
 
A
E
 
S
I
 
I
F
|
F
G
x
R
R
|
R
L
 
L
T
 
S
V
 
V
E
 
Y
E
 
D
N
 
N
L
 
L
L
 
M
M
 
A
G
 
V
L
 
L
-
 
Q
-
 
I
-
 
R
S
 
D
R
 
D
F
 
L
P
 
S
G
 
A
S
 
E
E
 
Q
A
 
R
K
 
E
E
 
D
V
 
R
P
 
A
A
 
N
F
 
E
I
 
L
Y
 
M
E
 
E
L
 
E
F
 
F
P
 
H
V
 
I
L
 
-
L
 
E
Q
 
H
M
 
L
K
 
R
Q
 
D
R
 
S
R
 
M
G
 
G
G
 
Q
D
 
S
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
E
Q
 
R
Q
 
R
Q
 
R
L
 
V
A
 
E
I
 
I
G
 
A
R
 
R
A
 
A
L
 
L
A
 
A
S
 
A
R
 
N
P
 
P
R
 
K
L
 
F
L
 
I
I
 
L
L
 
L
D
 
D
E
 
E
P
 
P
T
 
F
E
 
A
G
 
G
I
 
V
Q
 
D
P
 
P
S
 
I
V
 
S
I
 
V
K
 
I
E
 
D
I
 
I
G
 
K
A
 
R
V
 
I
I
 
I
K
 
E
Q
 
H
L
 
L
A
 
R
A
 
D
R
 
S
G
 
G
D
 
-
M
 
L
A
 
G
I
 
V
L
 
L
L
 
I
V
 
T
E
 
D
Q
 
H
F
 
N
Y
 
V
D
 
R
F
 
E
A
 
T
A
 
L
E
 
A
L
 
V
A
 
C
D
 
E
Q
 
R
Y
 
A
L
 
Y
V
 
I
M
 
V
S
 
S
R
 
Q
G
 
G
E
 
H
I
 
L
V
 
I
Q
 
A
Q
 
H
G
 
G

Q8IUA7 ATP-binding cassette sub-family A member 9; EC 7.6.2.- from Homo sapiens (Human) (see 2 papers)
32% identity, 94% coverage: 2:218/232 of query aligns to 481:700/1624 of Q8IUA7

query
sites
Q8IUA7
L
 
I
Q
 
R
V
 
I
D
 
K
T
 
N
L
 
L
H
 
K
Q
 
K
Y
 
E
Y
 
Y
G
 
A
G
 
G
S
 
K
-
 
C
-
 
E
-
 
R
-
 
V
H
 
E
I
 
A
L
 
L
R
 
K
G
 
G
L
 
V
T
 
V
F
 
F
E
 
D
V
 
I
K
 
Y
V
 
E
G
 
G
E
 
Q
V
 
I
T
 
T
C
 
A
L
 
L
L
 
L
G
 
G
R
 
H
N
 
S
G
 
G
V
 
A
G
 
G
K
 
K
T
 
T
T
 
T
L
 
L
L
 
L
K
 
N
C
 
I
L
 
L
M
 
S
G
 
G
L
 
L
L
 
S
P
 
V
A
 
P
K
 
T
E
 
S
G
 
G
A
 
S
V
 
V
N
 
T
W
 
V
E
 
Y
G
 
N
K
 
H
P
 
T
I
 
L
T
 
S
T
 
R
F
 
M
K
 
A
P
 
D
H
 
I
Q
 
E
R
 
N
V
 
I
H
 
S
A
 
K
G
 
F
I
 
T
A
 
G
Y
 
F
V
 
C
P
 
P
Q
 
Q
G
 
S
R
 
N
E
 
V
I
 
Q
F
 
F
G
 
G
R
 
F
L
 
L
T
 
T
V
 
V
E
 
K
E
 
E
N
 
N
L
 
L
-
 
R
-
 
L
-
 
F
-
 
A
-
 
K
L
 
I
M
 
K
G
 
G
L
 
I
S
 
-
R
 
-
F
 
L
P
 
P
G
 
H
S
 
E
E
 
V
A
 
E
K
 
K
E
 
E
V
 
V
P
 
Q
A
 
R
F
 
V
I
 
V
Y
 
Q
E
 
E
L
 
L
F
 
-
P
 
-
V
 
E
L
 
M
L
 
E
Q
 
N
M
 
I
K
 
Q
Q
 
D
R
 
I
R
 
L
G
 
A
G
 
Q
D
 
N
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
Q
Q
 
N
Q
 
R
Q
 
K
L
 
L
A
 
T
I
 
F
G
 
G
R
 
I
A
 
A
L
 
I
A
 
L
S
 
G
R
 
D
P
 
P
R
 
Q
L
 
V
L
 
L
I
 
L
L
 
L
D
 
D
E
 
E
P
 
P
T
 
T
E
 
A
G
 
G
I
 
L
Q
 
D
P
 
P
S
 
L
V
 
S
I
 
R
K
 
H
E
 
R
I
 
I
G
 
W
A
 
N
V
 
L
I
 
L
K
 
K
Q
 
E
L
 
-
A
 
-
A
 
G
R
 
K
G
 
S
D
 
D
M
 
R
A
 
V
I
 
I
L
 
L
L
 
F
V
 
S
E
 
T
Q
 
Q
F
 
F
Y
 
I
D
 
D
F
 
E
A
 
A
A
 
D
E
 
I
L
 
L
A
 
A
D
 
D
Q
 
R
Y
 
K
L
 
V
V
 
F
M
 
I
S
 
S
R
 
N
G
 
G
E
 
K
I
 
L
V
 
K
Q
 
C
Q
 
A
G
 
G
R
 
S
G
 
S

Sites not aligning to the query:

6mbnA Lptb e163q in complex with atp (see paper)
28% identity, 93% coverage: 2:216/232 of query aligns to 4:219/241 of 6mbnA

query
sites
6mbnA
L
 
L
Q
 
T
V
 
A
D
 
K
T
 
N
L
 
L
H
 
A
Q
 
K
Y
 
A
Y
|
Y
G
 
K
G
 
G
S
x
R
H
 
R
I
x
V
L
 
V
R
 
E
G
 
D
L
 
V
T
 
S
F
 
L
E
 
T
V
 
V
K
 
N
V
 
S
G
 
G
E
 
E
V
 
I
T
 
V
C
 
G
L
 
L
L
 
L
G
 
G
R
 
P
N
|
N
G
|
G
V
 
A
G
|
G
K
|
K
T
|
T
T
|
T
L
 
T
L
 
F
K
 
Y
C
 
M
L
 
V
M
 
V
G
 
G
L
 
I
L
 
V
P
 
P
A
 
R
K
 
D
E
 
A
G
 
G
A
 
N
V
 
I
N
 
I
W
 
I
E
 
D
G
 
D
K
 
D
P
 
D
I
 
I
T
 
S
T
 
L
F
 
L
K
 
P
P
 
L
H
 
H
Q
 
A
R
 
R
V
 
A
H
 
R
A
 
R
G
 
G
I
 
I
A
 
G
Y
 
Y
V
 
L
P
 
P
Q
 
Q
G
 
E
R
 
A
E
 
S
I
 
I
F
 
F
G
 
R
R
 
R
L
 
L
T
 
S
V
 
V
E
 
Y
E
 
D
N
 
N
L
 
L
L
 
M
M
 
A
G
 
V
L
 
L
-
 
Q
-
 
I
-
 
R
S
 
D
R
 
D
F
 
L
P
 
S
G
 
A
S
 
E
E
 
Q
A
 
R
K
 
E
E
 
D
V
 
R
P
 
A
A
 
N
F
 
E
I
 
L
Y
 
M
E
 
E
L
 
E
F
 
F
P
 
H
V
 
I
L
 
-
L
 
E
Q
 
H
M
 
L
K
 
R
Q
 
D
R
 
S
R
 
M
G
 
G
G
 
Q
D
 
S
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
E
Q
 
R
Q
 
R
Q
 
R
L
 
V
A
 
E
I
 
I
G
 
A
R
 
R
A
 
A
L
 
L
A
 
A
S
 
A
R
 
N
P
 
P
R
 
K
L
 
F
L
 
I
I
 
L
L
 
L
D
 
D
E
 
Q
P
 
P
T
 
F
E
 
A
G
 
G
I
 
V
Q
 
D
P
 
P
S
 
I
V
 
S
I
 
V
K
 
I
E
 
D
I
 
I
G
 
K
A
 
R
V
 
I
I
 
I
K
 
E
Q
 
H
L
 
L
A
 
R
A
 
D
R
 
S
G
 
G
D
 
-
M
 
L
A
 
G
I
 
V
L
 
L
L
 
I
V
 
T
E
 
D
Q
x
H
F
 
N
Y
 
V
D
 
R
F
 
E
A
 
T
A
 
L
E
 
A
L
 
V
A
 
C
D
 
E
Q
 
R
Y
 
A
L
 
Y
V
 
I
M
 
V
S
 
S
R
 
Q
G
 
G
E
 
H
I
 
L
V
 
I
Q
 
A
Q
 
H
G
 
G

Q8N139 ATP-binding cassette sub-family A member 6; EC 7.6.2.- from Homo sapiens (Human) (see 2 papers)
32% identity, 87% coverage: 12:212/232 of query aligns to 492:691/1617 of Q8N139

query
sites
Q8N139
G
 
G
G
 
K
S
 
V
H
 
E
I
 
A
L
 
L
R
 
K
G
 
G
L
 
L
T
 
L
F
 
F
E
 
D
V
 
I
K
 
Y
V
 
E
G
 
G
E
 
Q
V
 
I
T
 
T
C
 
A
L
 
I
L
 
L
G
 
G
R
 
H
N
 
S
G
 
G
V
 
A
G
 
G
K
 
K
T
 
S
T
 
S
L
 
L
L
 
L
K
 
N
C
 
I
L
 
L
M
 
N
G
 
G
L
 
L
L
 
S
P
 
V
A
 
P
K
 
T
E
 
E
G
 
G
A
 
S
V
 
V
N
 
T
W
 
I
E
 
Y
G
 
N
K
 
K
P
 
N
I
 
L
T
 
S
T
 
E
F
 
M
K
 
Q
P
 
D
H
 
L
Q
 
E
R
 
E
V
 
I
H
 
R
A
 
K
G
 
I
I
 
T
A
 
G
Y
 
V
V
 
C
P
 
P
Q
 
Q
G
 
F
R
 
N
E
 
V
I
 
Q
F
 
F
G
 
D
R
 
I
L
 
L
T
 
T
V
 
V
E
 
K
E
 
E
N
 
N
L
 
L
L
 
S
M
 
L
G
 
-
L
 
F
S
 
A
R
 
K
F
 
I
P
 
K
G
 
G
S
 
I
E
 
H
A
 
L
K
 
K
E
 
E
V
 
V
P
 
E
A
 
Q
F
 
-
I
 
-
Y
 
-
E
 
E
L
 
V
F
 
Q
P
 
R
V
 
I
L
 
L
L
 
L
Q
 
E
M
 
L
K
 
D
Q
 
M
R
 
Q
R
 
N
G
 
I
G
 
Q
D
 
D
-
 
N
-
 
L
-
 
A
-
 
K
-
 
H
L
 
L
S
 
S
G
 
E
G
 
G
Q
 
Q
Q
 
K
Q
 
R
Q
 
K
L
 
L
A
 
T
I
 
F
G
 
G
R
 
I
A
 
T
L
 
I
A
 
L
S
 
G
R
 
D
P
 
P
R
 
Q
L
 
I
L
 
L
I
 
L
L
 
L
D
 
D
E
 
E
P
 
P
T
 
T
E
 
T
G
 
G
I
 
L
Q
 
D
P
 
P
S
 
F
V
 
S
I
 
R
K
 
D
E
 
Q
I
 
V
G
 
W
A
 
S
V
 
L
I
 
L
K
 
R
Q
 
E
L
 
-
A
 
-
A
 
R
R
 
R
G
 
A
D
 
D
M
 
H
A
 
V
I
 
I
L
 
L
L
 
F
V
 
S
E
 
T
Q
 
Q
F
 
S
Y
 
M
D
 
D
F
 
E
A
 
A
A
 
D
E
 
I
L
 
L
A
 
A
D
 
D
Q
 
R
Y
 
K
L
 
V
V
 
I
M
 
M
S
 
S
R
 
N
G
 
G
E
 
R
I
 
L

Sites not aligning to the query:

Query Sequence

>Pf1N1B4_1347 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1347
MLQVDTLHQYYGGSHILRGLTFEVKVGEVTCLLGRNGVGKTTLLKCLMGLLPAKEGAVNW
EGKPITTFKPHQRVHAGIAYVPQGREIFGRLTVEENLLMGLSRFPGSEAKEVPAFIYELF
PVLLQMKQRRGGDLSGGQQQQLAIGRALASRPRLLILDEPTEGIQPSVIKEIGAVIKQLA
ARGDMAILLVEQFYDFAAELADQYLVMSRGEIVQQGRGENMEAEGVRGLVTI

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1)