Comparing Pf1N1B4_1382 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1382 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ip9A Structure of atu2422-gaba receptor in complex with gaba (see paper)
51% identity, 92% coverage: 28:375/377 of query aligns to 2:348/348 of 3ip9A
3ip7A Structure of atu2422-gaba receptor in complex with valine (see paper)
51% identity, 92% coverage: 28:375/377 of query aligns to 2:348/348 of 3ip7A
3ip6A Structure of atu2422-gaba receptor in complex with proline (see paper)
51% identity, 92% coverage: 28:375/377 of query aligns to 2:348/348 of 3ip6A
3ip5A Structure of atu2422-gaba receptor in complex with alanine (see paper)
51% identity, 92% coverage: 28:375/377 of query aligns to 2:348/348 of 3ip5A
3ipcA Structure of atu2422-gaba f77a mutant receptor in complex with leucine (see paper)
51% identity, 92% coverage: 28:375/377 of query aligns to 2:348/348 of 3ipcA
1z18A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound valine (see paper)
43% identity, 90% coverage: 28:368/377 of query aligns to 2:338/344 of 1z18A
1z17A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound ligand isoleucine (see paper)
43% identity, 90% coverage: 28:368/377 of query aligns to 2:338/344 of 1z17A
1z16A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound leucine (see paper)
43% identity, 90% coverage: 28:368/377 of query aligns to 2:338/344 of 1z16A
1uskA L-leucine-binding protein with leucine bound (see paper)
41% identity, 90% coverage: 28:368/377 of query aligns to 2:340/345 of 1uskA
1usiA L-leucine-binding protein with phenylalanine bound (see paper)
41% identity, 90% coverage: 28:368/377 of query aligns to 2:340/345 of 1usiA
4n0qB Crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic)
41% identity, 91% coverage: 27:369/377 of query aligns to 1:341/345 of 4n0qB
4q6bA Crystal structure of abc transporter substrate-binding protein fromdesulfitobacterium hafniense complex with leu
29% identity, 92% coverage: 28:373/377 of query aligns to 2:335/335 of 4q6bA
4mlcA Abc transporter substrate-binding protein fromdesulfitobacterium hafniense
29% identity, 92% coverage: 28:373/377 of query aligns to 2:336/336 of 4mlcA
4gnrA 1.0 angstrom resolution crystal structure of the branched-chain amino acid transporter substrate binding protein livj from streptococcus pneumoniae str. Canada mdr_19a in complex with isoleucine
32% identity, 85% coverage: 29:350/377 of query aligns to 3:322/348 of 4gnrA
3td9A Crystal structure of a leucine binding protein livk (tm1135) from thermotoga maritima msb8 at 1.90 a resolution
29% identity, 82% coverage: 29:336/377 of query aligns to 2:306/350 of 3td9A
4rdcA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with proline
26% identity, 90% coverage: 29:368/377 of query aligns to 3:355/364 of 4rdcA
4qymA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with methionine
26% identity, 90% coverage: 29:368/377 of query aligns to 3:355/364 of 4qymA
4otzA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with cystein
26% identity, 90% coverage: 29:368/377 of query aligns to 3:355/364 of 4otzA
4og2A The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with leucine
26% identity, 90% coverage: 29:368/377 of query aligns to 3:355/364 of 4og2A
4oatA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with isoleucine.
26% identity, 90% coverage: 29:368/377 of query aligns to 3:355/364 of 4oatA
>Pf1N1B4_1382 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1382
MSQTFYKKGFLALAVATALGVSAFAQADIKIGVAGPMTGANAAFGEQYMKGAQAAADAVN
AAGGVNGEKIVLVKGDDACEPKQAVTVAKDLTNQKVAGVVGHFCSSSTIPASEIYDEAGI
IAITPGSTNPAVTERGLSAMFRMCGRDDQQGIVAGDYIVDVLKGKKVVVLHDKDTYGQGL
ADATKAQLAKRGVTPVLYEGLTRGEKDFSTIVTKIRGAGADVVYFGGLHPEAGPLVRQLR
EQGLKDVKFMSDDGIVTDELVTTAGGPQFVDGVLMTFGADPRLLPDSKTVVDDFRKKGTE
PEGYTLYAYASVQTLAAAFNGAKSNKGEEAAAWLKKNPVKTVMGEKTWDSKGDLKISDYV
VYQWDKDGKYHQLEKQK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory