SitesBLAST
Comparing Pf1N1B4_1687 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1687 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8hfkA Crystal structure of cbar mutant (h162f) in complex with NADP+ and halogenated aryl ketone (see paper)
45% identity, 97% coverage: 7:244/246 of query aligns to 9:257/259 of 8hfkA
- binding 2-bromanyl-1-(4-bromanyl-2-oxidanyl-phenyl)ethanone: S143 (= S141), N144 (≠ S142), T145 (= T143), F153 (≠ Y151), Y156 (= Y154), G187 (= G185), M193 (≠ L191), V197 (≠ K196)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), R18 (= R16), I20 (= I18), A40 (= A38), N41 (≠ S39), S42 (= S40), D66 (= D64), N93 (= N91), S94 (≠ A92), L116 (≠ I114), T141 (≠ F139), Y156 (= Y154), K160 (= K158), P186 (= P184), G187 (= G185), G188 (≠ P186), T189 (≠ V187), T191 (= T189), M193 (≠ L191)
Sites not aligning to the query:
8hfjC Crystal structure of cbar mutant (h162f) in complex with NADP+ and a bulky 1,3-cyclodiketone (see paper)
45% identity, 97% coverage: 7:244/246 of query aligns to 9:258/260 of 8hfjC
- binding 2-methyl-2-[(4-methylphenyl)methyl]cyclopentane-1,3-dione: N144 (≠ S142), T145 (= T143), F154 (≠ Y151), G189 (≠ P186), V198 (≠ K196)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), R18 (= R16), I20 (= I18), Y39 (= Y37), A40 (= A38), N41 (≠ S39), S42 (= S40), D66 (= D64), V67 (= V65), N93 (= N91), S94 (≠ A92), L116 (≠ I114), T141 (≠ F139), Y157 (= Y154), K161 (= K158), P187 (= P184), T190 (≠ V187), T192 (= T189), M194 (≠ L191)
Sites not aligning to the query:
7yb2D Crystal structure of anthrol reductase (cbar) in complex with NADP+ and emodin (see paper)
45% identity, 97% coverage: 7:244/246 of query aligns to 13:262/264 of 7yb2D
- binding 3-methyl-1,6,8-trihydroxyanthraquinone: S147 (= S141), Y161 (= Y154), G193 (≠ P186), M198 (≠ L191), F199 (= F192), V202 (≠ K196), S203 (= S197), Y206 (≠ Q200)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G13), R22 (= R16), G23 (= G17), I24 (= I18), Y43 (= Y37), A44 (= A38), N45 (≠ S39), S46 (= S40), D70 (= D64), V71 (= V65), N97 (= N91), S98 (≠ A92), L120 (≠ I114), T145 (≠ F139), S147 (= S141), Y161 (= Y154), K165 (= K158), P191 (= P184), G192 (= G185), T194 (≠ V187), T196 (= T189), M198 (≠ L191)
4fj2B Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and biochanin a (see paper)
41% identity, 97% coverage: 7:244/246 of query aligns to 9:258/260 of 4fj2B
- active site: G19 (= G17), S143 (= S141), N144 (≠ S142), H154 (≠ Y151), Y157 (= Y154), K161 (= K158), Y202 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), R18 (= R16), G19 (= G17), I20 (= I18), A40 (= A38), N41 (≠ S39), S42 (= S40), I67 (≠ V65), N93 (= N91), S94 (≠ A92), G95 (= G93), L116 (≠ I114), T141 (≠ F139), Y157 (= Y154), K161 (= K158), G188 (= G185), G189 (≠ P186), T190 (≠ V187), T192 (= T189), M194 (≠ L191)
- binding 5,7-dihydroxy-3-(4-methoxyphenyl)-4H-chromen-4-one: G189 (≠ P186), F195 (= F192), V198 (vs. gap), S199 (vs. gap), Y202 (vs. gap), I203 (vs. gap), M217 (≠ N203), A218 (≠ F204)
3qwiA Crystal structure of a 17beta-hydroxysteroid dehydrogenase (holo form) from fungus cochliobolus lunatus in complex with NADPH and coumestrol (see paper)
41% identity, 97% coverage: 7:244/246 of query aligns to 9:258/260 of 3qwiA
- active site: G19 (= G17), S143 (= S141), N144 (≠ S142), H154 (≠ Y151), Y157 (= Y154), K161 (= K158), Y202 (vs. gap)
- binding Coumestrol: F149 (≠ M146), G189 (≠ P186), M194 (≠ L191), Y202 (vs. gap), I203 (vs. gap), A218 (≠ F204)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), R18 (= R16), I20 (= I18), A40 (= A38), N41 (≠ S39), S42 (= S40), I67 (≠ V65), N93 (= N91), S94 (≠ A92), G95 (= G93), L116 (≠ I114), T141 (≠ F139), Y157 (= Y154), K161 (= K158), P187 (= P184), G188 (= G185), G189 (≠ P186), T190 (≠ V187), T192 (= T189), M194 (≠ L191)
3qwhA Crystal structure of the 17beta-hydroxysteroid dehydrogenase from cochliobolus lunatus in complex with NADPH and kaempferol (see paper)
41% identity, 97% coverage: 7:244/246 of query aligns to 9:258/260 of 3qwhA
- active site: G19 (= G17), S143 (= S141), N144 (≠ S142), H154 (≠ Y151), Y157 (= Y154), K161 (= K158), Y202 (vs. gap)
- binding 3,5,7-trihydroxy-2-(4-hydroxyphenyl)-4h-chromen-4-one: N144 (≠ S142), F149 (≠ M146), G189 (≠ P186), F195 (= F192), S199 (vs. gap), Y202 (vs. gap), I203 (vs. gap), A218 (≠ F204)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), R18 (= R16), G19 (= G17), I20 (= I18), A40 (= A38), N41 (≠ S39), S42 (= S40), D66 (= D64), I67 (≠ V65), N93 (= N91), S94 (≠ A92), G95 (= G93), L116 (≠ I114), T141 (≠ F139), Y157 (= Y154), K161 (= K158), P187 (= P184), G188 (= G185), G189 (≠ P186), T190 (≠ V187), T192 (= T189), M194 (≠ L191)
4fj0D Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and 3,7-dihydroxy flavone (see paper)
41% identity, 97% coverage: 7:244/246 of query aligns to 10:259/261 of 4fj0D
- active site: G20 (= G17), S144 (= S141), N145 (≠ S142), H155 (≠ Y151), Y158 (= Y154), K162 (= K158), Y203 (vs. gap)
- binding 3,7-dihydroxy-2-phenyl-4H-chromen-4-one: S144 (= S141), N145 (≠ S142), G190 (≠ P186), F196 (= F192), S200 (vs. gap), Y203 (vs. gap), A219 (≠ F204)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G13), R19 (= R16), G20 (= G17), I21 (= I18), A41 (= A38), N42 (≠ S39), S43 (= S40), I68 (≠ V65), N94 (= N91), S95 (≠ A92), G96 (= G93), L117 (≠ I114), T142 (≠ F139), Y158 (= Y154), K162 (= K158), P188 (= P184), G189 (= G185), G190 (≠ P186), T191 (≠ V187), T193 (= T189), M195 (≠ L191)
4fj1B Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and genistein (see paper)
41% identity, 97% coverage: 7:244/246 of query aligns to 8:257/259 of 4fj1B
- active site: G18 (= G17), S142 (= S141), N143 (≠ S142), H153 (≠ Y151), Y156 (= Y154), K160 (= K158), Y201 (vs. gap)
- binding genistein: G188 (≠ P186), F194 (= F192), S198 (vs. gap), Y201 (vs. gap), I202 (vs. gap), M216 (≠ N203), A217 (≠ F204)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G13), R17 (= R16), G18 (= G17), I19 (= I18), A39 (= A38), N40 (≠ S39), S41 (= S40), I66 (≠ V65), N92 (= N91), S93 (≠ A92), G94 (= G93), L115 (≠ I114), T140 (≠ F139), S142 (= S141), Y156 (= Y154), K160 (= K158), G187 (= G185), T189 (≠ V187), T191 (= T189), M193 (≠ L191)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
42% identity, 98% coverage: 4:245/246 of query aligns to 2:244/246 of 3osuA
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
42% identity, 98% coverage: 6:245/246 of query aligns to 1:237/239 of 3sj7A
- active site: G12 (= G17), S138 (= S141), Q148 (≠ Y151), Y151 (= Y154), K155 (= K158)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), S10 (= S15), R11 (= R16), I13 (= I18), N31 (= N36), Y32 (= Y37), A33 (= A38), G34 (≠ S39), S35 (= S40), A58 (= A63), N59 (≠ D64), V60 (= V65), N86 (= N91), A87 (= A92), T109 (≠ I114), S138 (= S141), Y151 (= Y154), K155 (= K158), P181 (= P184), G182 (= G185)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
41% identity, 100% coverage: 1:245/246 of query aligns to 6:252/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G13), S20 (= S15), K21 (≠ R16), G22 (= G17), I23 (= I18), A43 (= A38), S44 (= S39), S45 (= S40), G68 (≠ A63), D69 (= D64), V70 (= V65), N96 (= N91), S97 (≠ A92), G98 (= G93), Y100 (≠ L95), I144 (≠ F139), S146 (= S141), Y159 (= Y154), K163 (= K158), P189 (= P184), G190 (= G185), M191 (≠ P186), I192 (≠ V187), T194 (= T189), G196 (≠ F192), T197 (≠ L193)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S141), Y159 (= Y154), M191 (≠ P186), I202 (vs. gap)
1g0nA Structure of trihydroxynaphthalene reductase in complex with NADPH and 4,5,6,7-tetrachloro-phthalide (see paper)
38% identity, 97% coverage: 7:244/246 of query aligns to 20:270/273 of 1g0nA
- active site: G30 (= G17), S154 (= S141), H165 (≠ Y151), Y168 (= Y154), K172 (= K158)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G26 (= G13), R29 (= R16), G30 (= G17), I31 (= I18), A51 (= A38), N52 (≠ S39), S53 (= S40), V78 (= V65), N104 (= N91), S105 (≠ A92), G106 (= G93), I127 (= I114), M152 (≠ F139), Y168 (= Y154), K172 (= K158), P198 (= P184), G200 (≠ P186), I201 (≠ V187), T203 (= T189), M205 (≠ L191)
- binding 4,5,6,7-tetrachloro-phthalide: S154 (= S141), Y168 (= Y154), G200 (≠ P186), M205 (≠ L191), Y206 (≠ F192), C210 (vs. gap), Y213 (vs. gap), W233 (≠ M207)
1dohA Structure of trihydroxynaphthalene reductase in complex with NADPH and 4-nitro-inden-1-one (see paper)
38% identity, 97% coverage: 7:244/246 of query aligns to 20:270/273 of 1dohA
- active site: G30 (= G17), S154 (= S141), H165 (≠ Y151), Y168 (= Y154), K172 (= K158), Y213 (vs. gap)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G26 (= G13), R29 (= R16), G30 (= G17), I31 (= I18), A51 (= A38), N52 (≠ S39), S53 (= S40), N77 (≠ D64), V78 (= V65), N104 (= N91), S105 (≠ A92), G106 (= G93), M152 (≠ F139), Y168 (= Y154), K172 (= K158), P198 (= P184), G200 (≠ P186), I201 (≠ V187), T203 (= T189), M205 (≠ L191)
- binding 4-nitro-inden-1-one: Y168 (= Y154), G200 (≠ P186), Y206 (≠ F192), C210 (vs. gap), Y213 (vs. gap)
1ybvA Structure of trihydroxynaphthalene reductase in complex with NADPH and an active site inhibitor (see paper)
38% identity, 97% coverage: 7:244/246 of query aligns to 17:267/270 of 1ybvA
- active site: G27 (= G17), S151 (= S141), H162 (≠ Y151), Y165 (= Y154), K169 (= K158), Y210 (vs. gap)
- binding 5-methyl-1,2,4-triazolo[3,4-b]benzothiazole: S151 (= S141), Y165 (= Y154), G197 (≠ P186), M202 (≠ L191), Y203 (≠ F192), Y210 (vs. gap), W230 (≠ M207)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G23 (= G13), R26 (= R16), G27 (= G17), I28 (= I18), A48 (= A38), N49 (≠ S39), S50 (= S40), N74 (≠ D64), V75 (= V65), N101 (= N91), S102 (≠ A92), G103 (= G93), M149 (≠ F139), S151 (= S141), K169 (= K158), P195 (= P184), G197 (≠ P186), I198 (≠ V187), T200 (= T189), M202 (≠ L191)
1g0oC Structure of trihydroxynaphthalene reductase in complex with NADPH and pyroquilon (see paper)
38% identity, 97% coverage: 7:244/246 of query aligns to 28:278/281 of 1g0oC
- active site: G38 (= G17), S162 (= S141), H173 (≠ Y151), Y176 (= Y154), K180 (= K158), Y221 (vs. gap)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G34 (= G13), R37 (= R16), G38 (= G17), I39 (= I18), A59 (= A38), N60 (≠ S39), S61 (= S40), N85 (≠ D64), V86 (= V65), N112 (= N91), S113 (≠ A92), G114 (= G93), M160 (≠ F139), Y176 (= Y154), K180 (= K158), P206 (= P184), G208 (≠ P186), I209 (≠ V187), T211 (= T189), M213 (≠ L191)
- binding pyroquilon: S162 (= S141), I163 (≠ S142), Y176 (= Y154), G208 (≠ P186), Y221 (vs. gap)
Q12634 Tetrahydroxynaphthalene reductase; T4HN reductase; THNR; EC 1.1.1.252 from Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae) (see 2 papers)
38% identity, 97% coverage: 7:244/246 of query aligns to 30:280/283 of Q12634
- 39:63 (vs. 16:40, 48% identical) binding
- Y178 (= Y154) active site, Proton acceptor
3iccA Crystal structure of a putative 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis at 1.87 a resolution (see paper)
38% identity, 97% coverage: 7:244/246 of query aligns to 8:252/255 of 3iccA
- active site: G18 (= G17), S148 (= S141), F158 (≠ Y151), Y161 (= Y154), K165 (= K158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G13), S16 (= S15), R17 (= R16), G18 (= G17), I19 (= I18), H37 (≠ N36), Y38 (= Y37), G39 (≠ A38), L66 (≠ V65), E67 (≠ A66), N98 (= N91), G100 (= G93), I146 (≠ F139), S148 (= S141), Y161 (= Y154), K165 (= K158), P191 (= P184), G192 (= G185), M198 (≠ L191), N199 (≠ F192)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
43% identity, 100% coverage: 1:246/246 of query aligns to 1:245/247 of P73574
- A14 (= A14) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (= P149) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K158) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ P186) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ K196) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
1ja9A Crystal structure of 1,3,6,8-tetrahydroxynaphthalene reductase in complex with NADPH and pyroquilon (see paper)
39% identity, 97% coverage: 7:244/246 of query aligns to 7:257/259 of 1ja9A
- active site: G17 (= G17), S141 (= S141), H152 (≠ Y151), Y155 (= Y154), K159 (= K158), D194 (vs. gap)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), R16 (= R16), G17 (= G17), I18 (= I18), G38 (≠ A38), S39 (= S39), S40 (= S40), A63 (= A63), I65 (≠ V65), N91 (= N91), S92 (≠ A92), G93 (= G93), L114 (≠ I114), T139 (≠ F139), S141 (= S141), Y155 (= Y154), K159 (= K158), P185 (= P184), G187 (≠ P186), V188 (= V187), T190 (= T189), M192 (≠ L191)
- binding pyroquilon: S141 (= S141), I142 (vs. gap), Y155 (= Y154), G187 (≠ P186), F193 (= F192), S197 (vs. gap), Y200 (vs. gap)
Sites not aligning to the query:
4iqgD Crystal structure of bpro0239 oxidoreductase from polaromonas sp. Js666 in NADP bound form
38% identity, 97% coverage: 6:244/246 of query aligns to 2:247/248 of 4iqgD
- active site: G13 (= G17), N112 (≠ H115), S143 (= S141), Y154 (= Y151), Y157 (= Y154), K161 (= K158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G13), S11 (= S15), R12 (= R16), G13 (= G17), I14 (= I18), N32 (= N36), A34 (= A38), S35 (= S39), N36 (≠ S40), A59 (= A63), D60 (= D64), V61 (= V65), N87 (= N91), A88 (= A92), G89 (= G93), V141 (≠ F139), S143 (= S141), Y157 (= Y154), K161 (= K158), P187 (= P184), G188 (= G185), I190 (≠ V187), T192 (= T189), I194 (≠ L191), H195 (≠ F192)
Query Sequence
>Pf1N1B4_1687 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1687
MTAQTSKVAIVTGASRGIGAVIARQLASEGFAVAINYASSATEASKLVVELRQAGHQAIA
IKADVANADDVRRLFDETETQLGKVDVLVNNAGILKVLPLAQHSDELFDQNFNIHARGTF
NTLREAATRLNSGGRIINFSSSTVGMNLPGYAVYIASKAAVESLTQVFAKEMRGRNITVN
AVAPGPVATDLFLHGKSEEQIQNFAKMPPLERLGQPEDIARVVSFLVGPDSAWVNGQILR
VNGGLV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory