Comparing Pf1N1B4_1690 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1690 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
3q1xA Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-serine (see paper)
53% identity, 55% coverage: 124:292/308 of query aligns to 96:263/267 of 3q1xA
3p47A Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-cysteine (see paper)
53% identity, 55% coverage: 124:292/308 of query aligns to 98:265/270 of 3p47A
7bw9A Crystal structure of serine acetyltransferase isoform 3 in complex with cysteine from entamoeba histolytica
40% identity, 83% coverage: 35:289/308 of query aligns to 24:252/280 of 7bw9A
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
44% identity, 54% coverage: 125:290/308 of query aligns to 74:230/243 of 4n69A
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
40% identity, 53% coverage: 127:290/308 of query aligns to 54:220/233 of 4n6bA
Sites not aligning to the query:
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
36% identity, 57% coverage: 115:290/308 of query aligns to 61:227/258 of 4h7oA
Sites not aligning to the query:
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
38% identity, 52% coverage: 131:290/308 of query aligns to 82:232/261 of 6wyeA
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
38% identity, 52% coverage: 131:290/308 of query aligns to 80:230/243 of 7ra4A
4hzdA Crystal structure of serine acetyltransferase in complex with coenzyme a from brucella abortus strain s19 (see paper)
38% identity, 55% coverage: 123:290/308 of query aligns to 73:231/250 of 4hzdA
Sites not aligning to the query:
1ssqD Serine acetyltransferase- complex with cysteine (see paper)
36% identity, 57% coverage: 115:290/308 of query aligns to 61:227/257 of 1ssqD
1t3dA Crystal structure of serine acetyltransferase from e.Coli at 2.2a (see paper)
35% identity, 57% coverage: 115:290/308 of query aligns to 65:231/262 of 1t3dA
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
39% identity, 51% coverage: 134:291/308 of query aligns to 87:235/272 of 3gvdI
8i04A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with serine (see paper)
35% identity, 57% coverage: 115:290/308 of query aligns to 61:227/258 of 8i04A
8i09A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with butyl gallate (see paper)
35% identity, 57% coverage: 115:290/308 of query aligns to 64:230/246 of 8i09A
Sites not aligning to the query:
8i06A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with coa (see paper)
35% identity, 57% coverage: 115:290/308 of query aligns to 65:231/244 of 8i06A
Sites not aligning to the query:
1sstA Serine acetyltransferase- complex with coa (see paper)
35% identity, 57% coverage: 115:290/308 of query aligns to 61:220/233 of 1sstA
Sites not aligning to the query:
>Pf1N1B4_1690 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1690
VSERSSHWQLQTIVSQLRTAREQWRVQNGRASGEQGGRELPSRAAMADILEALCGALFPM
RLGPVDLREESEDFYVGHTLDVALNALLAQARLELRYAARHSAQADTEVEAKTIQIIQDF
ALALPGLRTLLDTDVLAAYHGDPAARSVDEVLLCYPGILAVIHHRLAHHLYRAGLPLLAR
ISAEIAHSATGIDIHPGAQIGRSFFIDHGTGVVIGETAIIGERVRIYQAVTLGAKRFPAD
EDGQLQKGHPRHPIVEDDVVIYAGATILGRITIGKGSTIGGNVWLTRSVPAGCNLSQANL
QHDDGTQK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory