Comparing Pf1N1B4_1711 ABC-type polar amino acid transport system, ATPase component to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3c4jA Abc protein artp in complex with atp-gamma-s
54% identity, 92% coverage: 4:241/260 of query aligns to 3:240/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
54% identity, 92% coverage: 4:241/260 of query aligns to 3:240/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
54% identity, 92% coverage: 4:241/260 of query aligns to 3:240/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
54% identity, 92% coverage: 4:241/260 of query aligns to 3:240/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
53% identity, 93% coverage: 4:244/260 of query aligns to 2:241/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
53% identity, 89% coverage: 12:242/260 of query aligns to 9:239/240 of 4ymuJ
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
44% identity, 89% coverage: 10:240/260 of query aligns to 8:250/258 of 1b0uA
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
44% identity, 89% coverage: 10:240/260 of query aligns to 12:254/258 of P02915
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 92% coverage: 4:241/260 of query aligns to 1:243/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
37% identity, 92% coverage: 4:241/260 of query aligns to 2:244/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
37% identity, 92% coverage: 4:241/260 of query aligns to 2:244/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
37% identity, 92% coverage: 4:241/260 of query aligns to 2:244/344 of 3tuiC
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
36% identity, 95% coverage: 1:247/260 of query aligns to 14:256/378 of P69874
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
36% identity, 90% coverage: 24:258/260 of query aligns to 46:282/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
36% identity, 90% coverage: 24:258/260 of query aligns to 46:282/382 of 7aheC
Sites not aligning to the query:
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
39% identity, 92% coverage: 3:242/260 of query aligns to 1:232/374 of 2awnB
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
39% identity, 92% coverage: 3:242/260 of query aligns to 1:232/371 of 3puyA
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
39% identity, 92% coverage: 3:242/260 of query aligns to 1:232/371 of 3puxA
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
39% identity, 92% coverage: 3:242/260 of query aligns to 1:232/371 of 3puwA
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
39% identity, 92% coverage: 3:242/260 of query aligns to 1:232/371 of 3puvA
>Pf1N1B4_1711 ABC-type polar amino acid transport system, ATPase component
MSALIEFKGFNKFFGEQQVLDGIDLQVKPGEVIVILGPSGCGKSTLLRCLNGLEVAHSGS
LNFAGRELLDKGTDWREVRQQIGMVFQSYHLFPHMSVLDNLLLGPLKVQKRERREARAQA
EALLERVGLLDKREAFPRQLSGGQQQRIAIVRSLCMNPKVMLFDEVTAALDPEMVKEVLE
VIQGLAREGMTLLIVTHEMAFARAVADRIVFMDAGRILEQHPPEIFFTNPQTARAQQFLE
KFSYVAALPKTTQTKELELS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory