SitesBLAST
Comparing Pf1N1B4_1816 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1816 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3gqtC Crystal structure of glutaryl-coa dehydrogenase from burkholderia pseudomallei with fragment (1,4-dimethyl-1,2,3,4- tetrahydroquinoxalin-6-yl)methylamine (see paper)
84% identity, 99% coverage: 5:392/393 of query aligns to 1:385/385 of 3gqtC
- active site: L135 (= L139), T136 (= T140), A250 (= A251), E365 (= E372), R377 (= R384)
- binding 1-(1,4-dimethyl-1,2,3,4-tetrahydroquinoxalin-6-yl)methanamine: W166 (= W170), K210 (= K211), L213 (= L214), T218 (= T219), Y364 (= Y371)
3eonC 2.55a crystal structure of native glutaryl-coa dehydrogenase from burkholderia pseudomallei in complex with a small molecule (see paper)
83% identity, 98% coverage: 5:391/393 of query aligns to 1:382/382 of 3eonC
3gncA Crystal structure of glutaryl-coa dehydrogenase from burkholderia pseudomallei with fragment 6421 (see paper)
83% identity, 98% coverage: 5:391/393 of query aligns to 2:380/380 of 3gncA
3d6bC 2.2 a crystal structure of glutaryl-coa dehydrogenase from burkholderia pseudomallei (see paper)
82% identity, 98% coverage: 5:391/393 of query aligns to 1:377/377 of 3d6bC
2r0nA The effect of a glu370asp mutation in glutaryl-coa dehydrogenase on proton transfer to the dienolate intermediate (see paper)
65% identity, 98% coverage: 7:392/393 of query aligns to 2:388/390 of 2r0nA
- active site: L133 (= L139), T134 (= T140), A247 (= A251), E368 (= E372), R380 (= R384)
- binding flavin-adenine dinucleotide: F131 (= F137), L133 (= L139), T134 (= T140), G139 (= G145), S140 (= S146), W166 (= W170), I167 (= I171), T168 (= T172), Y367 (= Y371), T370 (= T374), D372 (= D376)
- binding 3-thiaglutaryl-CoA: R92 (= R98), S93 (= S99), V97 (= V103), P142 (= P148), G238 (≠ K242), F241 (= F245), L244 (= L248), N245 (= N249), P318 (≠ V322), Y367 (= Y371), E368 (= E372), I377 (= I381)
1sirA The crystal structure and mechanism of human glutaryl-coa dehydrogenase (see paper)
65% identity, 98% coverage: 7:392/393 of query aligns to 2:388/390 of 1sirA
- active site: L133 (= L139), T134 (= T140), A247 (= A251), E368 (= E372), R380 (= R384)
- binding flavin-adenine dinucleotide: F131 (= F137), L133 (= L139), T134 (= T140), G139 (= G145), S140 (= S146), W166 (= W170), I167 (= I171), T168 (= T172), Y367 (= Y371), T370 (= T374)
- binding s-4-nitrobutyryl-coa: S93 (= S99), S140 (= S146), F241 (= F245), G242 (≠ T246), L244 (= L248), N245 (= N249), R248 (= R252), P318 (≠ V322), Y367 (= Y371), E368 (= E372), R380 (= R384)
2r0mA The effect of a glu370asp mutation in glutaryl-coa dehydrogenase on proton transfer to the dienolate intermediate (see paper)
65% identity, 98% coverage: 7:392/393 of query aligns to 2:388/390 of 2r0mA
- active site: L133 (= L139), T134 (= T140), A247 (= A251), D368 (≠ E372), R380 (= R384)
- binding 4-nitrobutanoic acid: L101 (= L107), Y367 (= Y371), D368 (≠ E372)
- binding flavin-adenine dinucleotide: F131 (= F137), L133 (= L139), T134 (= T140), G139 (= G145), S140 (= S146), W166 (= W170), I167 (= I171), T168 (= T172), L210 (= L214), Y367 (= Y371), T370 (= T374)
2ebaA Crystal structure of the putative glutaryl-coa dehydrogenase from thermus thermophilus
47% identity, 97% coverage: 10:392/393 of query aligns to 2:380/380 of 2ebaA
- active site: L131 (= L139), T132 (= T140), A239 (= A251), E360 (= E372), R372 (= R384)
- binding flavin-adenine dinucleotide: L131 (= L139), T132 (= T140), G136 (≠ H144), G137 (= G145), S138 (= S146), W161 (= W170), T163 (= T172), R265 (= R277), L272 (= L284), K275 (≠ T287), D333 (= D345), I334 (≠ M346), G337 (= G349), T355 (≠ V367), T358 (= T370), Y359 (= Y371), T362 (= T374)
3sf6A Crystal structure of glutaryl-coa dehydrogenase from mycobacterium smegmatis (see paper)
47% identity, 97% coverage: 11:392/393 of query aligns to 6:386/387 of 3sf6A
- active site: L134 (= L139), T135 (= T140), A245 (= A251), E366 (= E372), Q378 (≠ R384)
- binding dihydroflavine-adenine dinucleotide: F132 (= F137), L134 (= L139), T135 (= T140), G140 (= G145), S141 (= S146), W165 (= W170), I166 (= I171), T167 (= T172), S361 (≠ V367), T364 (= T370), Y365 (= Y371), T368 (= T374), E370 (≠ D376), M371 (≠ V377)
3swoA Crystal structure of a glutaryl-coa dehydrogenase from mycobacterium smegmatis in complex with fadh2 (see paper)
44% identity, 99% coverage: 4:392/393 of query aligns to 1:387/388 of 3swoA
- active site: L135 (= L139), T136 (= T140), A246 (= A251), E367 (= E372), K379 (≠ R384)
- binding dihydroflavine-adenine dinucleotide: F133 (= F137), L135 (= L139), T136 (= T140), G141 (= G145), S142 (= S146), W166 (= W170), I167 (= I171), T168 (= T172), R272 (= R277), V274 (≠ Q279), F275 (= F280), L279 (= L284), Y282 (≠ T287), T340 (≠ D345), L341 (≠ M346), G344 (= G349), I347 (= I352), T365 (= T370), Y366 (= Y371), T369 (= T374), E371 (≠ D376), M372 (≠ V377)
2ix5A Short chain specific acyl-coa oxidase from arabidopsis thaliana, acx4 in complex with acetoacetyl-coa (see paper)
36% identity, 96% coverage: 15:392/393 of query aligns to 35:412/415 of 2ix5A
- active site: L158 (= L139), T159 (= T140), S271 (≠ A251), E392 (= E372), R404 (= R384)
- binding acetoacetyl-coenzyme a: S165 (= S146), A167 (≠ P148), S168 (≠ G149), F261 (≠ L241), L268 (= L248), R272 (= R252), E392 (= E372), G393 (= G373), R404 (= R384)
- binding flavin-adenine dinucleotide: L158 (= L139), T159 (= T140), G164 (= G145), S165 (= S146), W189 (= W170), N239 (≠ T219), R297 (= R277), F300 (= F280), L304 (= L284), F307 (≠ T287), L309 (= L289), N310 (≠ I290), E365 (≠ D345), L366 (≠ M346), G368 (= G348), G369 (= G349), Y391 (= Y371), T394 (= T374), D396 (= D376), I397 (≠ V377)
2ix6A Short chain specific acyl-coa oxidase from arabidopsis thaliana, acx4 (see paper)
36% identity, 96% coverage: 15:392/393 of query aligns to 35:412/416 of 2ix6A
- active site: L158 (= L139), T159 (= T140), S271 (≠ A251), E392 (= E372), R404 (= R384)
- binding flavin-adenine dinucleotide: T159 (= T140), G164 (= G145), S165 (= S146), W189 (= W170), N239 (≠ T219), R297 (= R277), F300 (= F280), L304 (= L284), F307 (≠ T287), N310 (≠ I290), E365 (≠ D345), L366 (≠ M346), G369 (= G349), I372 (= I352), Y391 (= Y371), T394 (= T374), D396 (= D376)
Q96329 Acyl-coenzyme A oxidase 4, peroxisomal; AOX 4; G6p; Short-chain acyl-CoA oxidase; AtCX4; AtG6; SAOX; EC 1.3.3.6 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 96% coverage: 15:392/393 of query aligns to 51:428/436 of Q96329
4l1fA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
37% identity, 94% coverage: 15:385/393 of query aligns to 1:376/380 of 4l1fA
- active site: L125 (= L139), T126 (= T140), G242 (≠ A251), E363 (= E372), R375 (= R384)
- binding coenzyme a persulfide: T132 (≠ S146), H179 (vs. gap), F232 (≠ L241), M236 (≠ F245), E237 (≠ T246), L239 (= L248), D240 (≠ N249), R243 (= R252), Y362 (= Y371), E363 (= E372), G364 (= G373), R375 (= R384)
- binding flavin-adenine dinucleotide: F123 (= F137), L125 (= L139), T126 (= T140), G131 (= G145), T132 (≠ S146), F156 (≠ W170), I157 (= I171), T158 (= T172), R268 (= R277), Q270 (= Q279), F271 (= F280), I275 (≠ L284), F278 (≠ T287), L281 (≠ I290), Q336 (≠ D345), I337 (≠ M346), G340 (= G349), I358 (≠ V367), Y362 (= Y371), T365 (= T374), Q367 (≠ D376)
- binding 1,3-propandiol: L5 (= L19), Q10 (≠ R24)
2dvlA Crystal structure of project tt0160 from thermus thermophilus hb8
37% identity, 93% coverage: 19:384/393 of query aligns to 1:366/370 of 2dvlA
- active site: L121 (= L139), T122 (= T140), G233 (≠ A251), E354 (= E372), R366 (= R384)
- binding flavin-adenine dinucleotide: L121 (= L139), T122 (= T140), G127 (= G145), S128 (= S146), W152 (= W170), I153 (= I171), T154 (= T172), T356 (= T374), E358 (≠ D376)
5lnxD Crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis.
38% identity, 93% coverage: 20:384/393 of query aligns to 3:370/374 of 5lnxD
- active site: L122 (= L139), T123 (= T140), G239 (≠ A251), E358 (= E372), K370 (≠ R384)
- binding flavin-adenine dinucleotide: L122 (= L139), T123 (= T140), G128 (= G145), S129 (= S146), F153 (≠ W170), T155 (= T172), R265 (= R277), Q267 (= Q279), F268 (= F280), I272 (≠ L284), N275 (≠ T287), I278 (= I290), Q331 (≠ D345), I332 (≠ M346), G335 (= G349), Y357 (= Y371), T360 (= T374), E362 (≠ D376)
4n5fA Crystal structure of a putative acyl-coa dehydrogenase with bound fadh2 from burkholderia cenocepacia j2315
36% identity, 94% coverage: 15:384/393 of query aligns to 2:376/378 of 4n5fA
- active site: L126 (= L139), T127 (= T140), G243 (≠ A251), E364 (= E372), R376 (= R384)
- binding dihydroflavine-adenine dinucleotide: L126 (= L139), T127 (= T140), G132 (= G145), S133 (= S146), F157 (≠ W170), T159 (= T172), T210 (= T219), Y363 (= Y371), T366 (= T374), E368 (≠ D376), M372 (≠ L380)
8sgrA Isovaleryl-CoA dehydrogenase, mitochondrial (see paper)
34% identity, 93% coverage: 19:385/393 of query aligns to 12:387/393 of 8sgrA
- binding flavin-adenine dinucleotide: S135 (≠ T140), G140 (= G145), S141 (= S146), W165 (= W170), T167 (= T172), R279 (= R277), F282 (= F280), I286 (≠ L284), F289 (≠ T287), Q347 (≠ D345), C348 (≠ M346), G351 (= G349), L369 (≠ V367), G375 (= G373), T376 (= T374), L382 (= L380)
1ivhA Structure of human isovaleryl-coa dehydrogenase at 2.6 angstroms resolution: structural basis for substrate specificity (see paper)
34% identity, 93% coverage: 19:385/393 of query aligns to 8:383/387 of 1ivhA
- active site: M130 (≠ L139), S131 (≠ T140), E249 (≠ A251), A370 (≠ E372), R382 (= R384)
- binding coenzyme a persulfide: S137 (= S146), S185 (vs. gap), R186 (vs. gap), V239 (≠ L241), Y240 (≠ K242), M243 (≠ F245), E249 (≠ A251), R250 (= R252), G369 (≠ Y371), A370 (≠ E372), G371 (= G373), V375 (= V377)
- binding flavin-adenine dinucleotide: L128 (≠ F137), M130 (≠ L139), S131 (≠ T140), G136 (= G145), S137 (= S146), W161 (= W170), T163 (= T172), R275 (= R277), F278 (= F280), F285 (≠ T287), M288 (≠ I290), Q343 (≠ D345), C344 (≠ M346), G347 (= G349), T372 (= T374), E374 (≠ D376)
P26440 Isovaleryl-CoA dehydrogenase, mitochondrial; IVD; Butyryl-CoA dehydrogenase; EC 1.3.8.4; EC 1.3.8.1 from Homo sapiens (Human) (see 5 papers)
34% identity, 93% coverage: 19:385/393 of query aligns to 45:420/426 of P26440
- 165:174 (vs. 137:146, 40% identical) binding
- S174 (= S146) binding
- WIT 198:200 (= WIT 170:172) binding
- SR 222:223 (vs. gap) binding
- G250 (≠ A216) to A: in IVA; uncertain significance
- Y277 (≠ K242) binding
- DLER 284:287 (≠ NSAR 249:252) binding
- E286 (≠ A251) active site, Proton acceptor; mutation to D: Residual isovaleryl-CoA dehydrogenase activity.; mutation to G: Loss of isovaleryl-CoA dehydrogenase activity. Does not affect isovaleryl-CoA dehydrogenase activity; when associated with 407-E.; mutation to Q: Loss of isovaleryl-CoA dehydrogenase activity.
- A291 (≠ S256) to V: in IVA; uncertain significance; dbSNP:rs886042098
- R312 (= R277) binding
- Q323 (= Q288) binding
- I379 (≠ R344) to T: in IVA; uncertain significance
- QCFGG 380:384 (≠ DMLGG 345:349) binding
- R398 (≠ V363) to Q: in IVA; uncertain significance; dbSNP:rs1477527791
- Y403 (≠ V368) to N: in IVA; uncertain significance
- A407 (≠ E372) mutation to E: Does not affect isovaleryl-CoA dehydrogenase activity; when associated with 286-D.
- AG 407:408 (≠ EG 372:373) binding
- TSE 409:411 (≠ THD 374:376) binding
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
Query Sequence
>Pf1N1B4_1816 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1816
MGGKASFNWIDPLLLDQQLTEEERMIRDTAQQFAQQKLAPRVLEAFRHEKTDPAIFREMG
EVGLLGATIPEQYGGSGLNYVSYGLIAREVERVDSGYRSMMSVQSSLVMVPINEFGTEAQ
KQKYLPKLASGEWIGCFGLTEPDHGSDPGAMITRARKVEGGYSLTGSKMWITNSPIADVF
VVWGKDDAGDIRGFVLEKGWKGLSAPAIHGKVGLRASITGEIVMDNVFVPEENIFPDVRG
LKGPFTCLNSARYGISWGALGAAEFCWHTARQYTLDRKQFGRPLAATQLIQKKLADMQTE
ITMALQGCLRLGRMKDEGTAAVEITSMMKRNSCGKSLDIARMARDMLGGNGISDEFGVAR
HLVNLEVVNTYEGTHDVHALILGRAQTGIQAFY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory