Comparing Pf1N1B4_2033 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2033 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
23% identity, 51% coverage: 24:245/432 of query aligns to 64:299/587 of P25297
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
22% identity, 70% coverage: 12:315/432 of query aligns to 20:315/444 of Q8NLB7
Sites not aligning to the query:
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
25% identity, 58% coverage: 63:314/432 of query aligns to 47:277/403 of P77589
Sites not aligning to the query:
>Pf1N1B4_2033 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2033
MTTAPSSIAQPTQSTRPLTRNDYKTLSLSALGGALEFYDFIIFVFFATVVGKLFFPADMP
EWLRLMQTFGIFAAGYLARPLGGIVMAHFGDLLGRKKMFTLSIFMMAVPTLIMGLLPTYA
QIGMWAPILLLLMRVIQGAAIGGEVPGAWVFVSEHVPQRHIGYACGTLTSGLTAGILLGS
LVATAINSIYTPVEVSDYAWRIPFLLGGVFGLFSVYLRRWLHETPVFAELQLRKALAEEV
PLRAVLRDHRGAILISMLLTWLLSAAIVVLILMTPTVLQTVYHFAPTTALQSNSVAIVLL
SIGCIIAGALADRFGAGRVFVFGCAALLVSSWTFYHSLAEHPDWLFPMYAITGLLVGTIG
AVPYVMVKAFPPVVRFSGLSFSYNVAYAIFGGLTPMIVSLLLKESPMGPAYYVAVLCGVG
ILVGAYLWKKGR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory