Comparing Pf1N1B4_2170 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2170 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
3vayA Crystal structure of 2-haloacid dehalogenase from pseudomonas syringae pv. Tomato dc3000 (see paper)
70% identity, 98% coverage: 3:230/233 of query aligns to 2:229/230 of 3vayA
4ygrA Crystal structure of had phosphatase from thermococcus onnurineus (see paper)
34% identity, 54% coverage: 103:228/233 of query aligns to 83:211/215 of 4ygrA
Sites not aligning to the query:
3qnmA Haloalkane dehalogenase family member from bacteroides thetaiotaomicron of unknown function
28% identity, 95% coverage: 6:227/233 of query aligns to 6:230/231 of 3qnmA
6q7oA Crystal structure of oe1 (see paper)
29% identity, 54% coverage: 106:231/233 of query aligns to 100:230/230 of 6q7oA
Sites not aligning to the query:
6q7nA Crystal structure of bh32 alkylated with the mechanistic inhibitor 2- bromoacetophenone (see paper)
29% identity, 54% coverage: 106:231/233 of query aligns to 100:230/230 of 6q7nA
Sites not aligning to the query:
8bp1A Crystal structure of bhmehis1.0, an engineered enzyme for the morita- baylis-hillman reaction (see paper)
29% identity, 56% coverage: 101:231/233 of query aligns to 95:230/231 of 8bp1A
Sites not aligning to the query:
3i76B The crystal structure of the orthorhombic form of the putative had- hydrolase yfnb from bacillus subtilis bound to magnesium reveals interdomain movement
29% identity, 95% coverage: 6:227/233 of query aligns to 6:226/229 of 3i76B
2no5B Crystal structure analysis of a dehalogenase with intermediate complex (see paper)
28% identity, 57% coverage: 98:229/233 of query aligns to 88:225/226 of 2no5B
Sites not aligning to the query:
Q51645 (S)-2-haloacid dehalogenase 4A; 2-haloalkanoic acid dehalogenase IVA; Halocarboxylic acid halidohydrolase IVA; L-2-haloacid dehalogenase IVA; EC 3.8.1.2 from Burkholderia cepacia (Pseudomonas cepacia) (see 2 papers)
28% identity, 57% coverage: 98:229/233 of query aligns to 88:225/231 of Q51645
Sites not aligning to the query:
4knvA The crystal structure of apo human hdhd4 from se-mad (see paper)
26% identity, 97% coverage: 3:227/233 of query aligns to 1:232/241 of 4knvA
1zrmA Crystal structure of the reaction intermediate of l-2-haloacid dehalogenase with 2-chloro-n-butyrate (see paper)
26% identity, 94% coverage: 3:220/233 of query aligns to 2:213/220 of 1zrmA
2x4dB Crystal structure of human phospholysine phosphohistidine inorganic pyrophosphate phosphatase lhpp
32% identity, 59% coverage: 61:198/233 of query aligns to 51:184/213 of 2x4dB
Sites not aligning to the query:
Q53464 (S)-2-haloacid dehalogenase; 2-haloalkanoic acid dehalogenase; Halocarboxylic acid halidohydrolase; L-2-haloacid dehalogenase; L-DEX; EC 3.8.1.2 from Pseudomonas sp. (strain YL) (see 2 papers)
26% identity, 94% coverage: 3:220/233 of query aligns to 4:215/232 of Q53464
2x4dA Crystal structure of human phospholysine phosphohistidine inorganic pyrophosphate phosphatase lhpp
31% identity, 59% coverage: 61:198/233 of query aligns to 92:232/270 of 2x4dA
Sites not aligning to the query:
>Pf1N1B4_2170 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2170
MTIQLITFDLDDTLWDTAPVIASAEVILREWLTEHAPNLGAVPVEHLWSIRERVLSSEPN
LKHRISALRRRVLFHALEEAGYGHIEASDLADQGFEVFLHARHQIEVFPEVEPTLETLAK
HYALGVVTNGNADVRRLGLADYFKFALCAEDIGIAKPDARLFHEALQRGGATAETAVHIG
DHPGDDIAGAQQAGLRAIWFNPAGKVWEAQTAPDAEIRSLNELPGLLARWNTV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory