Comparing Pf1N1B4_2220 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2220 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
P0AGC0 Hexose-6-phosphate:phosphate antiporter from Escherichia coli (strain K12) (see paper)
34% identity, 94% coverage: 10:432/449 of query aligns to 6:444/463 of P0AGC0
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
26% identity, 86% coverage: 25:412/449 of query aligns to 1:381/409 of 6e9nA
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
24% identity, 90% coverage: 25:426/449 of query aligns to 12:414/430 of P0AA76
Q8BN82 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Mus musculus (Mouse) (see paper)
21% identity, 45% coverage: 112:314/449 of query aligns to 152:350/495 of Q8BN82
Sites not aligning to the query:
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
23% identity, 57% coverage: 59:315/449 of query aligns to 60:324/448 of Q51955
Sites not aligning to the query:
>Pf1N1B4_2220 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2220
MFAFFRPAAHQAPLPEEKIDSTYRRLRWQIFAGIFIGYAGYYLLRKNFTLAFPDLIAQGY
TKGQLGVAMSAIAIAYGLSKFLMGIVSDRSNPRYFLPFGLIVSAGVMFVFGFAPWATSSV
TMMFILLFINGWAQGMGWPPSGRTMVHWWSQKERGGVVSVWNTAHNVGGGLIGPLAILGM
GWFNDWHSKFYVPAAVALLVAVFAFIVMRDTPQSTGLPPIEKYKNDYPEGYDASHEEEFS
AKDIFVKYVLRNKMLWFIALANVFVYLLRYGILDWAPTYLKEVKHFDFDKTSWAYFLYEW
AGIPGTLLCGWMSDKIFRGNRGLTGMVFMALVTVATIVYWLNPPGNPMVDMISLFAIGFL
IYGPVMLVGLQALELVPKKAAGTAAGFTGLFGYLGGSVAASALMGYTVDYFGWDGGFILL
VVACLLAMAFLAPTLGHKNVASQSREAIA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory