SitesBLAST
Comparing Pf1N1B4_224 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_224 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q4WF54 Mevalonyl-coenzyme A hydratase sidH; Siderophore biosynthesis protein H; EC 4.2.1.- from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata) (see paper)
35% identity, 93% coverage: 18:263/265 of query aligns to 21:265/270 of Q4WF54
Sites not aligning to the query:
- 268:270 PTS1-type peroxisomal targeting signal
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
35% identity, 97% coverage: 8:263/265 of query aligns to 4:254/255 of 3q0jC
- active site: A65 (= A69), M70 (= M74), T80 (= T83), F84 (≠ N89), G108 (= G117), E111 (≠ G120), P130 (= P139), E131 (= E140), V136 (≠ L145), P138 (= P147), G139 (≠ A148), L224 (= L232), F234 (≠ A242)
- binding acetoacetyl-coenzyme a: Q23 (≠ D27), A24 (≠ S28), L25 (≠ R29), A27 (= A31), A63 (= A67), G64 (= G68), A65 (= A69), D66 (= D70), I67 (= I71), K68 (= K72), M70 (= M74), F84 (≠ N89), G107 (= G116), G108 (= G117), E111 (≠ G120), P130 (= P139), E131 (= E140), P138 (= P147), G139 (≠ A148), M140 (≠ Q149)
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
35% identity, 97% coverage: 8:263/265 of query aligns to 4:254/255 of 3q0gC
- active site: A65 (= A69), M70 (= M74), T80 (= T83), F84 (≠ N89), G108 (= G117), E111 (≠ G120), P130 (= P139), E131 (= E140), V136 (≠ L145), P138 (= P147), G139 (≠ A148), L224 (= L232), F234 (≠ A242)
- binding coenzyme a: L25 (≠ R29), A63 (= A67), I67 (= I71), K68 (= K72), Y104 (≠ A113), P130 (= P139), E131 (= E140), L134 (= L143)
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
35% identity, 97% coverage: 8:263/265 of query aligns to 3:253/256 of 3h81A
- active site: A64 (= A69), M69 (= M74), T79 (= T83), F83 (≠ N89), G107 (= G117), E110 (≠ G120), P129 (= P139), E130 (= E140), V135 (≠ L145), P137 (= P147), G138 (≠ A148), L223 (= L232), F233 (≠ A242)
- binding calcium ion: F233 (≠ A242), Q238 (≠ E247)
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
30% identity, 96% coverage: 8:261/265 of query aligns to 4:254/259 of 5zaiC
- active site: A65 (= A69), F70 (≠ M74), S82 (≠ R86), R86 (= R90), G110 (= G117), E113 (≠ G120), P132 (= P139), E133 (= E140), I138 (≠ L145), P140 (= P147), G141 (≠ A148), A226 (≠ L232), F236 (≠ A242)
- binding coenzyme a: K24 (≠ S28), L25 (≠ R29), A63 (= A67), G64 (= G68), A65 (= A69), D66 (= D70), I67 (= I71), P132 (= P139), R166 (= R172), F248 (= F255), K251 (= K258)
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
35% identity, 97% coverage: 8:263/265 of query aligns to 3:249/250 of 3q0gD
- active site: A64 (= A69), M69 (= M74), T75 (= T83), F79 (≠ N89), G103 (= G117), E106 (≠ G120), P125 (= P139), E126 (= E140), V131 (≠ L145), P133 (= P147), G134 (≠ A148), L219 (= L232), F229 (≠ A242)
- binding Butyryl Coenzyme A: F225 (≠ W238), F241 (= F255)
6slbAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
33% identity, 95% coverage: 10:261/265 of query aligns to 5:252/257 of 6slbAAA
- active site: Q64 (≠ A69), F69 (≠ M74), L80 (≠ Y85), N84 (= N89), A108 (≠ G117), S111 (≠ G120), A130 (≠ P139), F131 (≠ E140), L136 (= L145), P138 (= P147), D139 (≠ A148), A224 (≠ L232), G234 (≠ A242)
- binding (~{E})-6-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-6-oxidanylidene-hex-3-enoic acid: R58 (≠ G63), A62 (= A67), Q64 (≠ A69), D65 (= D70), L66 (≠ I71), Y76 (≠ G81), A108 (≠ G117), F131 (≠ E140), D139 (≠ A148)
6slaAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
33% identity, 95% coverage: 10:261/265 of query aligns to 2:240/245 of 6slaAAA
- active site: Q61 (≠ A69), L68 (≠ Y85), N72 (= N89), A96 (≠ G117), S99 (≠ G120), A118 (≠ P139), F119 (≠ E140), L124 (= L145), P126 (= P147), N127 (≠ A148), A212 (≠ L232), G222 (≠ A242)
- binding ~{S}-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyl] 2-(2,5-dihydrooxepin-7-yl)ethanethioate: L21 (≠ R29), A59 (= A67), Q61 (≠ A69), D62 (= D70), L63 (≠ I71), L68 (≠ Y85), Y71 (≠ L88), A94 (≠ L115), G95 (= G116), A96 (≠ G117), F119 (≠ E140), I122 (≠ L143), L124 (= L145), N127 (≠ A148), F234 (= F255), K237 (= K258)
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
31% identity, 94% coverage: 14:263/265 of query aligns to 13:257/260 of 1dubA
- active site: A68 (= A69), M73 (= M74), S83 (≠ A84), L87 (= L96), G111 (= G117), E114 (≠ G120), P133 (= P139), E134 (= E140), T139 (≠ L145), P141 (= P147), G142 (≠ A148), K227 (≠ Q226), F237 (≠ V243)
- binding acetoacetyl-coenzyme a: K26 (≠ D27), A27 (≠ S28), L28 (≠ R29), A30 (= A31), A66 (= A67), A68 (= A69), D69 (= D70), I70 (= I71), Y107 (≠ A113), G110 (= G116), G111 (= G117), E114 (≠ G120), P133 (= P139), E134 (= E140), L137 (= L143), G142 (≠ A148), F233 (= F239), F249 (= F255)
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
31% identity, 94% coverage: 14:263/265 of query aligns to 11:255/258 of 1ey3A
- active site: A66 (= A69), M71 (= M74), S81 (≠ A84), L85 (= L96), G109 (= G117), E112 (≠ G120), P131 (= P139), E132 (= E140), T137 (≠ L145), P139 (= P147), G140 (≠ A148), K225 (≠ Q226), F235 (≠ V243)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: K24 (≠ D27), L26 (≠ R29), A28 (= A31), A64 (= A67), G65 (= G68), A66 (= A69), D67 (= D70), I68 (= I71), L85 (= L96), W88 (≠ A99), G109 (= G117), P131 (= P139), L135 (= L143), G140 (≠ A148)
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
31% identity, 94% coverage: 14:263/265 of query aligns to 43:287/290 of P14604
- E144 (≠ G120) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (= E140) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
31% identity, 94% coverage: 14:263/265 of query aligns to 13:257/260 of 2hw5C
- active site: A68 (= A69), M73 (= M74), S83 (≠ A84), L87 (= L96), G111 (= G117), E114 (≠ G120), P133 (= P139), E134 (= E140), T139 (≠ L145), P141 (= P147), G142 (≠ A148), K227 (≠ Q226), F237 (≠ V243)
- binding crotonyl coenzyme a: K26 (≠ D27), A27 (≠ S28), L28 (≠ R29), A30 (= A31), K62 (≠ G63), I70 (= I71), F109 (≠ L115)
5jbxB Crystal structure of liuc in complex with coenzyme a and malonic acid (see paper)
32% identity, 91% coverage: 22:263/265 of query aligns to 19:258/261 of 5jbxB
- active site: A67 (= A69), R72 (≠ M74), L84 (≠ R86), R88 (≠ N89), G112 (= G117), E115 (≠ G120), T134 (≠ P139), E135 (= E140), I140 (≠ L145), P142 (= P147), G143 (≠ A148), A228 (≠ D233), L238 (≠ V243)
- binding coenzyme a: S24 (≠ D27), R25 (≠ S28), R26 (= R29), A28 (= A31), A65 (= A67), D68 (= D70), L69 (≠ I71), K70 (= K72), L110 (= L115), G111 (= G116), T134 (≠ P139), E135 (= E140), L138 (= L143), R168 (= R172)
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
30% identity, 94% coverage: 14:263/265 of query aligns to 12:251/254 of 2dubA
- active site: A67 (= A69), M72 (= M74), S82 (≠ E97), G105 (= G117), E108 (≠ G120), P127 (= P139), E128 (= E140), T133 (≠ L145), P135 (= P147), G136 (≠ A148), K221 (≠ Q226), F231 (≠ V243)
- binding octanoyl-coenzyme a: K25 (≠ D27), A26 (≠ S28), L27 (≠ R29), A29 (= A31), A65 (= A67), A67 (= A69), D68 (= D70), I69 (= I71), K70 (= K72), G105 (= G117), E108 (≠ G120), P127 (= P139), E128 (= E140), G136 (≠ A148), A137 (≠ Q149)
Q9LKJ1 3-hydroxyisobutyryl-CoA hydrolase 1; CoA-thioester hydrolase CHY1; EC 3.1.2.-; EC 3.1.2.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 67% coverage: 10:187/265 of query aligns to 11:190/378 of Q9LKJ1
- G70 (≠ A69) mutation to S: Loss of activity.
- E142 (= E140) mutation to A: Loss of activity.
- D150 (≠ A148) mutation to G: Reduced activity.
O53561 Enoyl-CoA hydratase EchA19; EC 4.2.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
28% identity, 95% coverage: 11:263/265 of query aligns to 11:263/266 of O53561
- K135 (≠ Q135) modified: N6-succinyllysine; mutation to E: Nearly wild-type levels of succinylation in vitro, reduces specific activity 8-fold.
- 135:142 (vs. 135:142, 38% identical) mutation to EFGISEAE: Very low levels of succinylation in vitro, reduces specific activity 15-fold.
- K142 (≠ S142) modified: N6-succinyllysine; mutation to E: About 50% succinylation in vitro, reduces specific activity 7-fold.
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
31% identity, 94% coverage: 14:263/265 of query aligns to 13:255/258 of 1mj3A
- active site: A68 (= A69), M73 (= M74), S83 (≠ R86), L85 (= L88), G109 (= G117), E112 (≠ G120), P131 (= P139), E132 (= E140), T137 (≠ L145), P139 (= P147), G140 (≠ A148), K225 (≠ Q226), F235 (≠ V243)
- binding hexanoyl-coenzyme a: K26 (≠ D27), A27 (≠ S28), L28 (≠ R29), A30 (= A31), A66 (= A67), G67 (= G68), A68 (= A69), D69 (= D70), I70 (= I71), G109 (= G117), P131 (= P139), E132 (= E140), L135 (= L143), G140 (≠ A148)
6l3pA Crystal strcuture of feruloyl-coa hydratase lyase(fchl) complexed with coa
31% identity, 67% coverage: 9:185/265 of query aligns to 9:183/244 of 6l3pA
- active site: M69 (≠ A69), Y74 (≠ M74), R86 (= R86), Q90 (≠ R90), G114 (= G117), S117 (≠ G120), S136 (≠ P139), E137 (= E140), I142 (≠ L145), P144 (= P147), G145 (≠ A148)
- binding coenzyme a: K28 (≠ S28), R29 (= R29), A31 (= A31), A67 (= A67), M69 (≠ A69), D70 (= D70), L71 (≠ I71), G113 (= G116)
Sites not aligning to the query:
4izdA Crystal structure of dmdd e121a in complex with mmpa-coa (see paper)
32% identity, 66% coverage: 14:187/265 of query aligns to 16:188/253 of 4izdA
- active site: L70 (≠ A69), H75 (≠ M74), C89 (≠ N89), H93 (≠ G93), G117 (= G117), A120 (≠ G120), E140 (= E140), G148 (≠ A148)
- binding 3-methylmercaptopropionate-CoA (MMPA-CoA): D29 (= D27), K30 (≠ S28), R31 (= R29), A33 (= A31), A68 (= A67), L70 (≠ A69), D71 (= D70), L72 (≠ I71)
Sites not aligning to the query:
3bptA Crystal structure of human beta-hydroxyisobutyryl-coa hydrolase in complex with quercetin
32% identity, 67% coverage: 21:197/265 of query aligns to 18:196/362 of 3bptA
- active site: G67 (≠ A69), P84 (vs. gap), R88 (= R86), G115 (= G117), G118 (= G120), E138 (= E140), D146 (≠ A148)
- binding (2r)-3-hydroxy-2-methylpropanoic acid: G66 (= G68), G67 (≠ A69), I69 (= I71), E90 (vs. gap), G114 (= G116), G115 (= G117), E138 (= E140), D146 (≠ A148), V147 (≠ Q149)
- binding 3,5,7,3',4'-pentahydroxyflavone: F25 (≠ S28), L26 (≠ R29), A28 (= A31), G66 (= G68), G67 (≠ A69), I69 (= I71), P137 (= P139), I141 (≠ L143)
Sites not aligning to the query:
Query Sequence
>Pf1N1B4_224 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_224
MNTLPICQTLLLERHNGVLHITLNRPDSRNAMSLQMVAELRAVLVAVRDDRQVRALVIGG
AGGHFCAGADIKDMANARAQGATAYRELNRAFGTLLEEAQHAPQVVITVLQGAVLGGGFG
LACVSDIAMADHQAQFGLPETSLGLLPAQIAPFVVQRIGLTQARRLALTAARFDGTQARR
MGLVHFVEHDPQALAERLDEVLAHVLCCAPGANAATKKLLLASAGQLSDGLLDQAAEWFS
EAVTGDEGIEGTMAFVQKRKPGWAI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory