Comparing Pf1N1B4_2242 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2242 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
7rsfA Acetylornithine deacetylase from escherichia coli
50% identity, 97% coverage: 3:378/389 of query aligns to 2:378/380 of 7rsfA
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
30% identity, 85% coverage: 45:375/389 of query aligns to 43:363/366 of Q8P8J5
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
30% identity, 85% coverage: 45:375/389 of query aligns to 44:358/360 of 2f7vA
7uoiA Crystallographic structure of dape from enterococcus faecium
27% identity, 85% coverage: 49:378/389 of query aligns to 46:382/383 of 7uoiA
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
25% identity, 88% coverage: 22:363/389 of query aligns to 14:360/375 of 4pqaA
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
25% identity, 88% coverage: 22:363/389 of query aligns to 14:360/376 of 4o23A
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
23% identity, 91% coverage: 24:376/389 of query aligns to 16:373/377 of 7t1qA
7lgpB Dape enzyme from shigella flexneri
23% identity, 93% coverage: 14:376/389 of query aligns to 3:374/377 of 7lgpB
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
25% identity, 68% coverage: 23:288/389 of query aligns to 15:282/377 of P44514
Sites not aligning to the query:
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
25% identity, 68% coverage: 23:288/389 of query aligns to 19:286/380 of 5vo3A
Sites not aligning to the query:
5xoyA Crystal structure of lysk from thermus thermophilus in complex with lysine (see paper)
27% identity, 92% coverage: 24:380/389 of query aligns to 14:340/341 of 5xoyA
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
23% identity, 78% coverage: 44:345/389 of query aligns to 45:364/408 of Q03154
Sites not aligning to the query:
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
29% identity, 55% coverage: 56:268/389 of query aligns to 82:301/426 of 3pfoA
Sites not aligning to the query:
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
25% identity, 58% coverage: 44:270/389 of query aligns to 45:285/407 of P37111
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
31% identity, 31% coverage: 23:143/389 of query aligns to 17:139/258 of 4h2kA
Sites not aligning to the query:
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
34% identity, 34% coverage: 35:167/389 of query aligns to 27:165/265 of 4op4B
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
45% identity, 16% coverage: 60:120/389 of query aligns to 114:177/507 of Q96KN2
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
45% identity, 16% coverage: 60:120/389 of query aligns to 83:146/471 of 3dljA
Sites not aligning to the query:
>Pf1N1B4_2242 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2242
MPLPSMKDQFAALIAAPSVSCTQPSLDQTNRPVIDLLATWLGDLGFACDIQQVSPGKFNL
LASFGSGPGGLVLAGHSDTVPYDEALWQTDPLKLTEVDGRWVGLGSCDMKGFFALAIEAV
KPLLDQPFKQPLLILATCDEESSMSGARALAEAGRPLGRAAVIGEPTGLKPIRMHKGIMM
ERIDILGQSGHSSDPRLGHSALEAMHDAMGELRGLRLAWQREFHNPQFSVPQPTLNFGCI
HGGDNPNRICGQCSLEFDLRPLPGMDPKALRAAILQKLNPIAERHKVKIDYAPLFPEVPP
FEQAEDSELVRVAEKLTGHRAEAVAFGTEAPYLQRLGCETLVLGPGDIACAHQPGEYLEM
SRLQPTVHLLRQLIEHYCLTPAKTAMPVS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory