SitesBLAST
Comparing Pf1N1B4_2251 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2251 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 74% coverage: 20:217/268 of query aligns to 23:229/378 of P69874
- C26 (≠ T23) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (= F24) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (= F42) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C51) mutation to T: Loss of ATPase activity and transport.
- L60 (= L57) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ A73) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V123) mutation to M: Loss of ATPase activity and transport.
- D172 (= D160) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
41% identity, 77% coverage: 17:222/268 of query aligns to 6:221/369 of P19566
- L86 (= L94) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P162) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D167) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
40% identity, 77% coverage: 17:222/268 of query aligns to 5:220/374 of 2awnB
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
40% identity, 77% coverage: 17:222/268 of query aligns to 5:220/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ F24), S37 (= S49), G38 (= G50), C39 (= C51), G40 (= G52), K41 (= K53), S42 (= S54), T43 (= T55), Q81 (= Q90), R128 (= R128), A132 (= A135), S134 (= S137), G136 (= G139), Q137 (= Q140), E158 (= E161), H191 (= H194)
- binding magnesium ion: S42 (= S54), Q81 (= Q90)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
40% identity, 77% coverage: 17:222/268 of query aligns to 5:220/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ F24), G38 (= G50), C39 (= C51), G40 (= G52), K41 (= K53), S42 (= S54), T43 (= T55), R128 (= R128), S134 (= S137), Q137 (= Q140)
- binding beryllium trifluoride ion: S37 (= S49), G38 (= G50), K41 (= K53), Q81 (= Q90), S134 (= S137), G136 (= G139), H191 (= H194)
- binding magnesium ion: S42 (= S54), Q81 (= Q90)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
40% identity, 77% coverage: 17:222/268 of query aligns to 5:220/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ F24), V17 (= V29), G38 (= G50), C39 (= C51), G40 (= G52), K41 (= K53), S42 (= S54), T43 (= T55), R128 (= R128), A132 (= A135), S134 (= S137), Q137 (= Q140)
- binding tetrafluoroaluminate ion: S37 (= S49), G38 (= G50), K41 (= K53), Q81 (= Q90), S134 (= S137), G135 (= G138), G136 (= G139), E158 (= E161), H191 (= H194)
- binding magnesium ion: S42 (= S54), Q81 (= Q90)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
40% identity, 77% coverage: 17:222/268 of query aligns to 5:220/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ F24), V17 (= V29), G38 (= G50), C39 (= C51), G40 (= G52), K41 (= K53), S42 (= S54), T43 (= T55), R128 (= R128), A132 (= A135), S134 (= S137), Q137 (= Q140)
- binding magnesium ion: S42 (= S54), Q81 (= Q90)
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
40% identity, 77% coverage: 17:222/268 of query aligns to 3:218/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ F24), S35 (= S49), G36 (= G50), C37 (= C51), G38 (= G52), K39 (= K53), S40 (= S54), T41 (= T55), R126 (= R128), A130 (= A135), S132 (= S137), G134 (= G139), Q135 (= Q140)
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
40% identity, 77% coverage: 17:222/268 of query aligns to 6:221/371 of P68187
- A85 (≠ R93) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (vs. gap) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (vs. gap) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ A116) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (= E118) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ V123) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G139) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D160) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
37% identity, 72% coverage: 22:214/268 of query aligns to 14:221/375 of 2d62A
1g291 Malk (see paper)
36% identity, 71% coverage: 22:212/268 of query aligns to 11:216/372 of 1g291
- binding magnesium ion: D69 (≠ E80), E71 (≠ R82), K72 (≠ E83), K79 (vs. gap), D80 (vs. gap)
- binding pyrophosphate 2-: S38 (= S49), G39 (= G50), C40 (= C51), G41 (= G52), K42 (= K53), T43 (≠ S54), T44 (= T55)
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
38% identity, 74% coverage: 17:214/268 of query aligns to 6:216/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
38% identity, 74% coverage: 17:214/268 of query aligns to 6:216/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
38% identity, 74% coverage: 17:214/268 of query aligns to 6:216/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
38% identity, 74% coverage: 17:214/268 of query aligns to 6:216/242 of 2oljA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 73% coverage: 19:214/268 of query aligns to 6:219/343 of P30750
- 40:46 (vs. 49:55, 86% identical) binding
- E166 (= E161) mutation to Q: Exhibits little ATPase activity.
Sites not aligning to the query:
- 278:283 binding
- 295 N→A: Reduces the binding of L-methionine to undetectable levels.
- 295:296 binding
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
38% identity, 73% coverage: 19:214/268 of query aligns to 7:220/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
38% identity, 73% coverage: 19:214/268 of query aligns to 7:220/344 of 3tuiC
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
37% identity, 74% coverage: 15:212/268 of query aligns to 2:212/240 of 4ymuJ
- binding adenosine-5'-triphosphate: F11 (= F24), V16 (= V29), S36 (= S49), G37 (= G50), S38 (≠ C51), G39 (= G52), K40 (= K53), S41 (= S54), T42 (= T55), E162 (= E161), H194 (= H194)
- binding magnesium ion: S41 (= S54), E162 (= E161)
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
38% identity, 73% coverage: 19:214/268 of query aligns to 7:220/344 of 6cvlD
- binding phosphothiophosphoric acid-adenylate ester: F12 (= F24), Q14 (vs. gap), I19 (vs. gap), S41 (= S49), G42 (= G50), A43 (≠ C51), G44 (= G52), K45 (= K53), S46 (= S54), T47 (= T55), N141 (≠ A135), S143 (= S137), Q146 (= Q140), H200 (= H194)
Query Sequence
>Pf1N1B4_2251 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2251
MTAQQPPRLLRGIPLVVRKLQKTFGSRQVLREIDLHIPAGQFVAVVGRSGCGKSTLLRLL
AGLDKPTGGELLAGAAPLSEAREDTRLMFQEARLLPWKKIIDNVGLGLKGNWRPQALEAL
EAVGLADRANEWPAALSGGQKQRVALARALIHQPRLLLLDEPLGALDALTRIEMQQLIER
LWQQHGFTVLLVTHDVSEAVAIADRVILIEEGEVGLDLPVELPRPRVRGSHRLAALETEV
LNRVLSLPGQPPEPEPVSPLPTQLRWAQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory