Comparing Pf1N1B4_2255 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2255 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
7d50B Spua mutant - h221n with glutamyl-thioester (see paper)
75% identity, 97% coverage: 1:250/258 of query aligns to 6:255/255 of 7d50B
7d53A Spua mutant - h221n with glu (see paper)
75% identity, 97% coverage: 2:250/258 of query aligns to 1:249/249 of 7d53A
7d4rB Spua native structure (see paper)
66% identity, 95% coverage: 4:247/258 of query aligns to 1:214/215 of 7d4rB
P76038 Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD; Gamma-Glu-GABA hydrolase; EC 3.5.1.94 from Escherichia coli (strain K12) (see paper)
45% identity, 96% coverage: 5:251/258 of query aligns to 8:252/254 of P76038
6vtvB Crystal structure of puud gamma-glutamyl-gamma-aminobutyrate hydrolase from e. Coli
45% identity, 96% coverage: 5:251/258 of query aligns to 6:250/252 of 6vtvB
3fijA Crystal structure of a uncharacterized protein lin1909
36% identity, 85% coverage: 27:245/258 of query aligns to 12:222/224 of 3fijA
O33341 Putative glutamine amidotransferase Rv2859c; EC 2.4.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 94% coverage: 5:247/258 of query aligns to 66:299/308 of O33341
1vcnA Crystal structure of t.Th. Hb8 ctp synthetase complex with sulfate anion (see paper)
30% identity, 48% coverage: 102:225/258 of query aligns to 353:485/506 of 1vcnA
Sites not aligning to the query:
2ywcA Crystal structure of gmp synthetase from thermus thermophilus in complex with xmp
25% identity, 83% coverage: 25:239/258 of query aligns to 8:180/475 of 2ywcA
Sites not aligning to the query:
>Pf1N1B4_2255 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2255
MSRLPLIGVTACSKQIGLHAYHISGDKYVRAVASAAKGLPLILPSLADLLAPSEILDALD
GILFTGSPSNIEPFHYNGPASAPGTAHDSARDATTLPLIRAAVEAGVPVLGICRGFQEMN
VAFGGSLHQKVHEAGPFMDHREDDSLPLDGQYAPSHPVHVQPGGVLAGLGLASEIQVNSI
HGQGIERLAPGLRVEAVAPDGLIEAVSVIEGKAFALGVQWHPEWQVSLNPDYLAIFQAFG
DACRKYALQRDADASNNA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory