Comparing Pf1N1B4_2257 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2257 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qx0B Transaminase structure of plurienzyme (tr2e2) in complex with plp (see paper)
64% identity, 96% coverage: 8:390/400 of query aligns to 2:379/443 of 7qx0B
5ti8B Crystal structure of an aspartate aminotransferase from pseudomonas (see paper)
72% identity, 85% coverage: 35:375/400 of query aligns to 1:307/384 of 5ti8B
Sites not aligning to the query:
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
64% identity, 92% coverage: 7:374/400 of query aligns to 2:370/450 of 6gwiB
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
67% identity, 89% coverage: 35:390/400 of query aligns to 2:358/422 of 7qx3A
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
62% identity, 92% coverage: 8:375/400 of query aligns to 2:370/453 of 6s4gA
7q9xAAA Probable aminotransferase
62% identity, 92% coverage: 8:375/400 of query aligns to 3:371/455 of 7q9xAAA
Sites not aligning to the query:
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
62% identity, 92% coverage: 8:375/400 of query aligns to 3:371/455 of 4a6tC
Sites not aligning to the query:
4ba5A Crystal structure of omega-transaminase from chromobacterium violaceum (see paper)
63% identity, 85% coverage: 35:375/400 of query aligns to 2:343/427 of 4ba5A
Sites not aligning to the query:
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
58% identity, 95% coverage: 10:388/400 of query aligns to 5:385/454 of 7ypmA
4a6rA Crystal structure of the omega transaminase from chromobacterium violaceum in the apo form, crystallised from polyacrylic acid (see paper)
62% identity, 85% coverage: 35:375/400 of query aligns to 1:339/423 of 4a6rA
Sites not aligning to the query:
7ypnD Crystal structure of transaminase cc1012 mutant m9 complexed with plp (see paper)
57% identity, 95% coverage: 10:388/400 of query aligns to 5:385/455 of 7ypnD
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
46% identity, 90% coverage: 18:376/400 of query aligns to 15:373/448 of 6io1B
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
47% identity, 85% coverage: 35:375/400 of query aligns to 35:380/460 of 5kr6B
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
44% identity, 90% coverage: 17:376/400 of query aligns to 9:372/451 of 6g4fA
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
44% identity, 90% coverage: 17:376/400 of query aligns to 9:372/451 of 6g4eA
Sites not aligning to the query:
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
44% identity, 90% coverage: 17:376/400 of query aligns to 9:372/453 of 6g4dB
5ghgB Transaminase w58l with smba
43% identity, 90% coverage: 18:375/400 of query aligns to 11:353/433 of 5ghgB
Sites not aligning to the query:
5kquC Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
46% identity, 85% coverage: 35:375/400 of query aligns to 33:378/459 of 5kquC
D6R3B6 Vanillin aminotransferase; Putative aminotransferase; pAMT; EC 2.6.1.119 from Capsicum frutescens (Cayenne pepper) (Tabasco pepper) (see paper)
43% identity, 93% coverage: 20:390/400 of query aligns to 14:388/459 of D6R3B6
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
45% identity, 85% coverage: 35:375/400 of query aligns to 31:376/455 of 5kr5A
Sites not aligning to the query:
>Pf1N1B4_2257 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2257
MTSNNPQTREWQALSSDHHLAPFSDFKQLKEKGPRIITSAKGVYLWDSEGNKILDGMAGL
WCVAIGYGRDELADAASKQMRELPYYNLFFQTAHPPVLELAKVISDVAPEGMNHVFFTGS
GSEGNDTMLRMVRHYWAIKGQPKKKVIISRKNGYHGSTVAGASLGGMTYMHEQGDLPIPG
IVHIAQPYWFGEGGDMTPNEFGIWAANQLEEKILEVGVDNVGAFIAEPIQGAGGVIIPPD
SYWPRIKEILAKYDILFVADEVICGFGRTGEWFGTDFYDLKPHMMTIAKGLTSGYIPMGG
LIVRDDVVEVLNEGGDFNHGFTYSGHPVAAAVALENIRILRDEKIVERVRTETAPYLQKR
LRELSDHPLVGEVRGSVCWGPSNWFRTKPPANVTKARALA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory